Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

OR51F2 Olfactory Receptor

Gene Symbol OR51F21 (View this gene in GeneCards)
Family 51
Subfamily F
Pseudogene No
CORP pseudogene probability score
Aliases OR11-23, HsOR11.3.25, ORL3391
External Ids HGNC: 15197   GeneBank: AB065529, BK004281, NM_001004753   ORDB: ORL3391   
Build #39 labels OR51F2
Chromosomal location 11:4,821,422-4,822,411 (+)
Cluster 11@5
Synteny CLIC#23
Remarks

Most Similar ORs in Humans (Paralogs)

Symbol Percent Length
OR51C4P 61.81% 309
OR51F1 63.14% 312
OR51F5P 63.14% 312

Most Similar ORs in other species (Orthologs)

Specie Symbol Percent Length
Dog OR51F2 87% 314
Chimp CONTIG465.144-14139 64% 312
Chimp CONTIG465.144-5117 61% 309
Chimp CONTIG465.140-6368 63% 300
Mouse Or51f2 84% 315
Rat Or51f2b 87% 315
Rat Or51f2 87% 315
Cow OR51F2 88% 313
Cow OR51F2CP 87% 313

Expression evidences

Source Accession
mRNA BC136877
GNF Atlas2 gnf1h10923_at

Sequence information

Nucleotide sequence ATGTCGGTCCTCAATAATACCATTGCTGAGCCTCTGATCTTCCTCCTGATGGGCATTCCA
GGCCTGAAAGCCACCCAGTACTGGATCTCCATCCCTTTTTGTCTCCTATATGTTGTTGCC
GTCTCTGGAAATAGCATGATCCTGTTTGTGGTCCTCTGTGAACGGAGCCTCCATAAGCCT
ATGTACTATTTCCTCTCTATGCTTTCAGCCACAGACCTGAGCTTGTCCCTGTGTACACTT
TCTACTACCCTTGGTGTCTTCTGGTTTGAAGCCCGAGAAATCAACCTAAATGCCTGCATT
GCCCAGATGTTCTTTCTACACGGATTTACTTTCATGGAGTCTGGGGTTCTACTGGCCATG
GCCTTTGATCGTTTTGTGGCCATCTGTTACCCACTGAGATACACTACCATCCTTACCAAT
GCCCGAATTGCCAAGATTGGGATGAGCATGTTGATAAGAAATGTTGCCGTCATGTTGCCA
GTCATGCTCTTTGTCAAGAGGTTGTCCTTCTGCAGTTCTATGGTCCTTTCACATTCTTAC
TGCTACCATGTTGATCTCATCCAACTCTCCTGCACAGACAATAGGATCAACAGCATCCTT
GGTCTGTTTGCGCTTTTGTCCACTACAGGGTTTGACTGCCCTTGCATCCTGCTCTCCTAT
ATCCTGATCATTCGATCTGTCCTCAGCATTGCTTCCTCAGAAGAGAGGCGGAAAGCCTTC
AACACCTGCACATCCCACATCAGTGCTGTTTCCATCTTCTACCTCCCTCTCATCAGTTTG
TCTCTTGTCCATCGCTATGGCCATTCAGCACCTCCATTTGTCCACATCATCATGGCCAAT
GTCTTTCTGCTAATCCCTCCTGTGCTCAACCCTATTATTTACAGTGTAAAGATTAAGCAG
ATTCAAAAGGCCATTATCAAGGTCTTAATTCAGAAGCACTCCAAATCTAATCATCAGCTA
TTTCTGATTAGAGATAAAGCCATTTATGAA
Conceptual translation MSVLNNTIAEPLIFLLMGIPGLKATQYWISIPFCLLYVVAVSGNSMILFVVLCERSLHKP
MYYFLSMLSATDLSLSLCTLSTTLGVFWFEAREINLNACIAQMFFLHGFTFMESGVLLAM
AFDRFVAICYPLRYTTILTNARIAKIGMSMLIRNVAVMLPVMLFVKRLSFCSSMVLSHSY
CYHVDLIQLSCTDNRINSILGLFALLSTTGFDCPCILLSYILIIRSVLSIASSEERRKAF
NTCTSHISAVSIFYLPLISLSLVHRYGHSAPPFVHIIMANVFLLIPPVLNPIIYSVKIKQ
IQKAIIKVLIQKHSKSNHQLFLIRDKAIYE

Protein domains and features

Variations - SNPs

Chr Start End Type Variation AA Change SNP IDs
11 100 -100 SYN C/A R/R 1000GP (YRI, YRI)
11 4,821,636 4,821,636 NS A/G D/G 1000GP (CEU)
11 4,821,934 4,821,934 SYN C/T C/C 1000GP (CEU)
11 4,822,169 4,822,169 NS G/C V/L 1000GP (CHBJPT)
11 4,842,862 4,842,862 NS A/G T/A rs61741857 (DbSNP)
11 4,842,866 4,842,866 NS A/G D/G rs35003053 (DbSNP)
11 4,842,914 4,842,914 NS G/T W/L rs61743166 (DbSNP)
11 4,842,925 4,842,925 SYN A/C R/R rs7114668 (DbSNP)
11 4,843,254 4,843,254 SYN A/T G/G rs7103540 (DbSNP)

Variations - CNVs

Chr Start End Type Sources
CopyNumber 88 (Hasin)
11 4,842,552 4,845,641 CopyNumber #119 (Waszak)

Haplotypes

Protein haplotypes were calculated using the 1000 genomes project as described in Olender T. et. al. BMC Genomics 2012.

T83A D84G W100L V262L % Freq CORP
1 T D W V 91.09 0.075
2 T G W V 7.91 0.075
3 A D L V 0.84 0.075
4 T D W L 0.15 0.075

AceView Gene Models

The information is based on AceView gene models, constructed from cDNA sequences. The information might be incomplete.

Accession Type Chr Start End Strand
OR51F2.aApr07-unspliced main_exon 5UTR chr11 4,821,386 4,821,422 +
CDS chr11 4,821,422 4,822,411 +
3UTR chr11 4,822,411 4,822,414 +