Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

OR51F3P Olfactory Receptor

Gene Symbol OR51F3P1 (View this gene in GeneCards)
Family 51
Subfamily F
Pseudogene Yes
CORP pseudogene probability score
Aliases HsOR11.3.20P
External Ids HGNC: 31281   GeneBank: NG_004323   
Build #39 labels
Chromosomal location 11:4,736,178-4,737,078 (-)
Cluster 11@5
Synteny CLIC#23
Remarks

Most Similar ORs in Humans (Paralogs)

Symbol Percent Length
OR51C4P 73.09% 301
OR51F4P 71.04% 297
OR51F5P 70.85% 295

Most Similar ORs in other species (Orthologs)

Specie Symbol Percent Length
Dog OR51F23 76% 301
Mouse Or51f23 74% 300
Rat Or51f4 74% 301
Cow OR51F17P 77% 301
Orang OR51F3 90% 297
Horse OR51F23F 77% 301
Chimp OR51F3 91% 301

Sequence information

Nucleotide sequence TCCTCTTCTCTGATCTTTTTCCTGACTGGAGTTCCAGGACTAGAAGTTGCTCATGCCTGG
ATCTCCATCCCCTTCTGCTGTCTCTACATAACTGCTCTCTCTGGAAATGGTGTCATTCTA
TTTGTCATCATCACTGAGTCCAGTCTCCACGAACCTATGTACTATTTCCTCTCTATGCTC
TCAACCACAGACCTGGGCTTGTGTGTTTCGACACTAGTCACTATGCTGGGCATATTCTGG
TTCAATGCAAGACAGATCAGTTTCCACGCCTGTGTTGCCCAGACGTTCTTCATTCAACTT
TTTACTGTCATGGAGTCCTCAGTGCTTCTGGCAATGGCCTTTGATCGCTTCATTGCCATT
TGTAACCCCCCGAGGTATACTACCATCTTGACTGATTCCAGGATCGTCAAAGTATGGTTT
GCCATCCTTGTCAGGGGGACCGTGATCCTATTGCCTCTGGCCCTACTTCTTAAACATGTC
CTTCTGCCAAAGTCATGTGCTCCATCATTCCTACTGTTTCCATCCTGATATCATCCAGCT
GTCATGTTCTGACAATAAGATCAACAGTGTTTTAGGACTCACTGCCCTCATAGTTACTGC
AGGAGTGGACTCCATCTTTATTCTTCTCTCCTATATCCTGATTATTAAGACCGTCCTAAG
CATTGCTTCCCCAGAGGAGCGGCATAAGGTCTTTAGCACTTGTATCTCCTACATAGGTGC
TGTTGCCATTTTCTACATCCCTCTCATTAGTTTGTGCTTTGTCCATAGGTTTGGGAAAAG
AGCGCCTCCTTATGCCCACACTCTTATGGCCAATGCATATTTGCTTATTCCACCAGTGAT
GAATCCTATTATTTATAGTGTGAAAACCAAGCAGATCCGTAGGGCCATTAAAAAAATCCT
T
Conceptual translation SSSLIFFLTGVPGLEVAHAWISIPFCCLYITALSGNGVILFVIITESSLHEPMYYFLSML
STTDLGLCVSTLVTMLG/ILVQCKT\SFHACVAQTFFIQLFTVMESSVLLAMAFDRFI
AICNPPRYTTILTDSRIVKVWFAILVRGTVILLPLALLLK\SFCQSHVLHHSYCFHPDI
IQLSCSDNKINSVLGLTALIVTAGVDSIFILLSYILIIKTVLSIASPEERHKVFSTCISY
IGAVAIFYIPLISLCFVHRFGKRAPPYAHTLMANAYLLIPPVMNPIIYSVKTKQIRRAIK
KIL

Protein domains and features

Variations - SNPs

Chr Start End Type Variation AA Change SNP IDs
11 100 -100 SNP T/C 1000GP (YRI, YRI, YRI, YRI, YRI, YRI)
11 4,736,262 4,736,262 SNP T/C 1000GP (CEU, CHBJPT)
11 4,736,534 4,736,534 SNP A/C 1000GP (CEU)
11 4,736,538 4,736,538 SNP C/T 1000GP (CEU)
11 4,736,708 4,736,708 SNP G/A 1000GP (CEU, CHBJPT)
11 4,736,890 4,736,890 SNP T/A 1000GP (CEU)
11 4,736,922 4,736,922 SNP T/C 1000GP (CEU)
11 4,757,492 4,757,492 SNP C/T rs10836558 (DbSNP)
11 4,757,506 4,757,506 SNP A/G rs12365096 (DbSNP)
11 4,757,938 4,757,938 SNP A/G rs10742372 (DbSNP)
11 4,758,120 4,758,120 SNP A/T rs10734443 (DbSNP)
11 4,758,152 4,758,152 SNP C/T rs11033618 (DbSNP)

Variations - CNVs

Chr Start End Type Sources
CopyNumber 85 (Hasin)

Haplotypes

Protein haplotypes were calculated using the 1000 genomes project as described in Olender T. et. al. BMC Genomics 2012.