Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

OR51F4P Olfactory Receptor

Gene Symbol OR51F4P1 (View this gene in GeneCards)
Family 51
Subfamily F
Pseudogene Yes
CORP pseudogene probability score
Aliases HsOR11.3.21P
External Ids HGNC: 31282   GeneBank: NG_004324   
Build #39 labels
Chromosomal location 11:4,752,046-4,752,944 (-)
Cluster 11@5
Synteny CLIC#23
Remarks

Most Similar ORs in Humans (Paralogs)

Symbol Percent Length
OR51C4P 75.33% 300
OR51F3P 71.04% 297
OR51F5P 71.67% 300

Most Similar ORs in other species (Orthologs)

Specie Symbol Percent Length
Dog OR51C4 78% 300
Chimp CONTIG465.140-6368 97% 300
Mouse Or51f4-ps 84% 300
Rat Or51f4 87% 300
Cow OR51F4 87% 300

Sequence information

Nucleotide sequence TTCCTCTTGACGGGGATCCCTGGACTTGAATGGGCCCATGTCTGGATCTCCATCCCCATC
TGCTGCCTCTATTTAACTGCCCTTTCTGGGAATACCCTGATCCTTTTTGTCATCCTCACT
GAGCCAACCCTCCATGAGACCATGTACTATTTCCTCTCCATGTTGTCCACCACTGACATT
GGCTTACGTATTTCTACACTGGTGACAGTGCTGGGAATATTCTGGCTCAATGCTCGGGAG
ATCAGCTTTAACACTTGTTTATCACAGATGTTCTTCATTCACCTCTTCACTTTCATGGAA
TCTTCAGTGCTCCTGGCTATGGCCTTTGATCATTTTGTGGCCATTTCTAACCCTTTAAGA
TATGCTACCATTCTAACTCATGCAAGAATAGCACAGATTGGTTTGGCAGTCATTACCAGG
GGGACTGTCATTTTGACACCACTAATCCTACTTCTTAAGTGACTGTCATTATGCCGCAGC
CACGTGCTCTGCCACTCCTACTGTTTCCACCCTGATGTGATGAAACTCTCATGTTCAGAC
ACAAAGATCAACAGTGCACTACGATTAAGTGCAATCATCTCTACTGCCGGAGTGGACTCC
ATCTTTATCTTGCTCTCCTATCTGCTGATCATTCGCTCAGGTCTCAGCATTGCATCCCCA
GAGGAGAGGAAGAAGGCCTTCAGCACCTGCATTTCTCATATCACTGCTGTTGGCATATTC
TACATCCCTTTGATCAGCCTGTCCTTTGTTCACAGATTTGGAAAACATGCCCCACCCTAT
GTGCCCACCCCCATTGCTAACGTATACTTGCTCATCCCCTCTGTGATGAATCCCCCATCA
TCTACAGTGTGAAAACAAAGCAGATTCAGAAAGCTGTGCTCAAATTTGTATGTTCCAAG
Conceptual translation FLLTGIPGLEWAHVWISIPICCLYLTALSGNTLILFVILTEPTLHETMYYFLSMLSTTDI
GLRISTLVTVLGIFWLNAREISFNTCLSQMFFIHLFTFMESSVLLAMAFDHFVAISNPLR
YATILTHARIAQIGLAVITRGTVILTPLILLLKXSLCRSHVLCHSYCFHPDVMKLSCSD
TKINSALRLSAIISTAGVDSIFILLSYLLIIRSGLSIASPEERKKAFSTCISHITAVGIF
YIPLISLSFVHRFGKHAPPYVPTPIANVYLLIPSVM/SPIIYSVKTKQIQKAVLKFVCS
K

Protein domains and features

Variations - SNPs

Chr Start End Type Variation AA Change SNP IDs
11 100 -100 SNP C/A 1000GP (YRI, YRI)
11 4,752,304 4,752,304 SNP C/A 1000GP (CEU, CHBJPT)
11 4,773,534 4,773,534 SNP A/C rs73393039 (DbSNP)
11 4,773,983 4,773,983 SNP A/G rs73393040 (DbSNP)

Variations - CNVs

Chr Start End Type Sources
CopyNumber 86 (Hasin)

Haplotypes

Protein haplotypes were calculated using the 1000 genomes project as described in Olender T. et. al. BMC Genomics 2012.