Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

OR51G1 Olfactory Receptor

Gene Symbol OR51G11 (View this gene in GeneCards)
Family 51
Subfamily G
Pseudogene No
CORP pseudogene probability score
Aliases OR11-29, HsOR11.3.35, ORL3445
External Ids HGNC: 14738   GeneBank: AB065793, BK004286, NM_001005237   ORDB: ORL3445   
Build #39 labels OR51G1, OR51G3P
Chromosomal location 11:4,923,377-4,924,339 (-)
Cluster 11@5
Synteny CLIC#23
Remarks Segregating Pseudo Gene, a nonsynonymous SNP in a highly conserved amino-acid (G->A at position 371, R130H)

Most Similar ORs in Humans (Paralogs)

Symbol Percent Length
OR51G2 63.82% 304

Most Similar ORs in other species (Orthologs)

Specie Symbol Percent Length
Dog OR51G1 90% 318
Chimp CONTIG465.123-1151 98% 321
Mouse Or51g1 89% 313
Rat Or51g1 88% 313
Cow OR51G1 89% 321
Cow OR51G1CP 80% 321

Expression evidences

Source Accession
mRNA BC136861
GNF Atlas2 gnf1h11128_at

Sequence information

Nucleotide sequence ATGACAATTCTTCTTAATAGCAGCCTCCAAAGAGCCACTTTCTTCCTGACGGGCTTCCAA
GGTCTAGAAGGTCTCCATGGCTGGATCTCTATTCCCTTCTGCTTCATCTACCTGACAGTT
ATCTTGGGGAACCTCACCATTCTCCACGTCATTTGTACTGATGCCACTCTCCATGGACCC
ATGTACTATTTCTTGGGCATGCTAGCTGTCACAGACTTAGGCCTTTGCCTTTCCACACTG
CCCACTGTGCTGGGCATTTTCTGGTTTGATACCAGAGAGATTGGCATCCCTGCCTGTTTC
ACTCAGCTCTTCTTCATCCACACCTTGTCTTCAATGGAGTCATCAGTTCTGTTATCCATG
TCCATTGACCGCTACGTGGCCGTCTGCAACCCACTGCATGACTCCACCGTCCTGACACCT
GCATGTATTGTCAAGATGGGGCTAAGCTCAGTGCTTAGAAGTGCTCTCCTCATCCTCCCC
TTGCCATTCCTCCTGAAGCGCTTCCAATACTGCCACTCCCATGTGCTGGCTCATGCTTAT
TGTCTTCACCTGGAGATCATGAAGCTGGCCTGCTCTAGCATCATTGTCAATCACATCTAT
GGGCTCTTTGTTGTGGCCTGCACCGTGGGTGTGGACTCCCTGCTCATCTTTCTCTCATAC
GCCCTCATCCTTCGCACCGTGCTCAGCATTGCCTCCCACCAGGAGCGACTCCGAGCCCTC
AACACCTGTGTCTCTCATATCTGTGCTGTACTGCTCTTCTACATCCCCATGATTGGCTTG
TCTCTTGTGCATCGCTTTGGTGAACATCTGCCCCGCGTTGTACACCTCTTCATGTCCTAT
GTGTATCTGCTGGTACCACCCCTTATGAACCCCATCATCTACAGCATCAAGACCAAGCAA
ATTCGCCAGCGCATCATTAAGAAGTTTCAGTTTATAAAGTCACTTAGGTGTTTTTGGAAG
GAT
Conceptual translation MTILLNSSLQRATFFLTGFQGLEGLHGWISIPFCFIYLTVILGNLTILHVICTDATLHGP
MYYFLGMLAVTDLGLCLSTLPTVLGIFWFDTREIGIPACFTQLFFIHTLSSMESSVLLSM
SIDRYVAVCNPLHDSTVLTPACIVKMGLSSVLRSALLILPLPFLLKRFQYCHSHVLAHAY
CLHLEIMKLACSSIIVNHIYGLFVVACTVGVDSLLIFLSYALILRTVLSIASHQERLRAL
NTCVSHICAVLLFYIPMIGLSLVHRFGEHLPRVVHLFMSYVYLLVPPLMNPIIYSIKTKQ
IRQRIIKKFQFIKSLRCFWKD

Protein domains and features

Variations - SNPs

Chr Start End Type Variation AA Change SNP IDs
11 100 -100 NS C/G Q/H 1000GP (YRI, YRI, YRI, YRI, YRI, YRI, YRI)
11 100 -100 SYN C/T L/L 1000GP (YRI, YRI)
11 4,923,562 4,923,562 SYN A/G L/L 1000GP (CHBJPT)
11 4,923,662 4,923,662 SYN G/C T/T 1000GP (CEU)
11 4,923,756 4,923,756 NS A/G I/T 1000GP (CEU)
11 4,923,966 4,923,966 NS T/G Y/S 1000GP (CEU, CHBJPT)
11 4,923,969 4,923,969 NS C/T R/H 1000GP (CEU)
11 4,923,999 4,923,999 NS G/A S/L 1000GP (CEU, CHBJPT)
11 4,924,003 4,924,003 NS C/T E/K 1000GP (CEU)
11 4,924,006 4,924,006 NS T/C M/V 1000GP (CEU)
11 4,944,661 4,944,661 NS C/G Q/H rs57920748 (DbSNP)
11 4,944,790 4,944,790 SYN C/T L/L rs59534473 (DbSNP)
11 4,944,792 4,944,792 SYN A/G L/L rs57025946 (DbSNP)
11 4,944,892 4,944,892 SYN C/G T/T rs34583466 (DbSNP)
11 4,944,986 4,944,986 NS A/G I/T rs12796015 (DbSNP)
11 4,945,196 4,945,196 NS T/G Y/S rs1378739 (DbSNP)
11 4,945,199 4,945,199 NS C/T R/H rs34742470 (DbSNP)
11 4,945,229 4,945,229 NS A/G L/S rs10836954 (DbSNP)
11 4,945,233 4,945,233 NS C/T E/K rs35264256 (DbSNP)
11 4,945,236 4,945,236 NS C/T V/M rs35666095 (DbSNP)
11 4,945,445 4,945,444 Ins(1) -/C rs35069588 (DbSNP)
11 4,945,539 4,945,539 NS T/C R/G rs61732340 (DbSNP)

Variations - CNVs

Chr Start End Type Sources
CopyNumber 166 (Hasin)
11 4,907,893 5,135,331 CopyNumber Variation_3835 (DGV)

Haplotypes

Protein haplotypes were calculated using the 1000 genomes project as described in Olender T. et. al. BMC Genomics 2012.

C317Y Q303H R302C V281A I195T V137I Q102* R11G % Freq CORP
1 C Q R V I V Q R 88.86 1.000
2 C Q R V T V Q R 6.07 1.000
3 C H R V I V Q R 2.15 1.000
4 C Q R A I V Q G 1.08 1.000
5 C Q R A I V Q R 0.84 1.000
6 C Q R A I I Q G 0.38 1.000
7 C Q C V I V Q R 0.23 1.000
8 C Q R V T V * R 0.23 1.200
9 Y Q R V I V Q R 0.15 1.000

AceView Gene Models

The information is based on AceView gene models, constructed from cDNA sequences. The information might be incomplete.

Accession Type Chr Start End Strand
OR51G1.aApr07-unspliced main_exon 3UTR chr11 4,923,374 4,923,377 -
CDS chr11 4,923,377 4,924,339 -