Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

OR51H1P Olfactory Receptor

Gene Symbol OR51H1P (View this gene in GeneCards)
Family 51
Subfamily H
Pseudogene Yes
CORP pseudogene probability score
Aliases OR11-25, HsOR11.3.28
External Ids GeneBank: AB065527, BK004279, NG_004388   
Build #39 labels OR51H1
Chromosomal location 11:4,859,620-4,860,564 (-)
Cluster 11@5
Synteny CLIC#23
Remarks

Most Similar ORs in Humans (Paralogs)

Symbol Percent Length
OR51H2P 62.38% 311

Most Similar ORs in other species (Orthologs)

Specie Symbol Percent Length
Chimp CONTIG465.127-8458 94% 315

Expression evidences

Source Accession
GNF Atlas2 gnf1h11156_at

Sequence information

Nucleotide sequence ATGACGAACTTGAATGCATCACAGGCCAACCACCGTAACTTCATTCTGACAGGTATCCCA
GGAACGCCAGACAAGAACCCATGGTTGGCCTTTCCCCTGGGATTTCTCTACACACTCACA
CTCCTGGGAAATGGTACCATCCTAGCTGTCATCAAGGTGGAGCCAAGTCTCCATGAGCCC
ACGTATTACTTCCTTTCTATCTTGGCTCTCACTGACGTTAGTCTCTCCATGTCCACCTTG
CCCTCCATGCTCAGCATCTACTGGTTTAATGCCCCTCAGATTGTTTTTGATGCATGCATC
ATGCAGATGTTCTTCATCCATGTATTTGGAATAGTAGAATCAGGAGTCCTAGTGTCCATG
GCCTTTGACAGATTTGTGGCCATCCGAAACCCATTACACTATGTTTCCATCCTCACTCAC
GATGTTATTCGAAAGACTGGAATAGCTGTCCTCACCCGGGCAGTCTGTGTGGTATTCCCT
GTGCCCTTCCTTATAAAGTGCCTACCCTTCTGCCATTCCAATGTCTTGTCTCATTCATAC
TGTCTTCACCAAAACATGATGCGGCTAGCTTGTGCCAGCACCCGCATCAACAGCCTCTAC
GGCCTCATCGTCGTCATCTTCACACTGGGGCTCGATGTTCTCCTCACTCTACTGTCTTAT
GTACTCACCCTGAAGACTGTGCTGGGCATTGTCTCCAGAGGTGAAAGGCTGAAAACCCTC
AGCACATGCCTCTCTCACATGTCTACCGTGCTCCTCTTCTATGTTCCTTTTATGGGTGCT
GCCTCCATGATCCACAGATTTTGGGAGCATTTATCACCAGTAGTGCACATGGTCATGGCT
GATATATACCTACTGCTCCCGCCTGTGCTAAACCCCATTGTCTACAGTGTGAAGACCAAG
CAAATTTGAAGAATGATCTTTCAAGTGTTCCAGAGGCAAAAAAAA
Conceptual translation MTNLNASQANHRNFILTGIPGTPDKNPWLAFPLGFLYTLTLLGNGTILAVIKVEPSLHEP
TYYFLSILALTDVSLSMSTLPSMLSIYWFNAPQIVFDACIMQMFFIHVFGIVESGVLVSM
AFDRFVAIRNPLHYVSILTHDVIRKTGIAVLTRAVCVVFPVPFLIKCLPFCHSNVLSHSY
CLHQNMMRLACASTRINSLYGLIVVIFTLGLDVLLTLLSYVLTLKTVLGIVSRGERLKTL
STCLSHMSTVLLFYVPF\VLPPXTDFG/HLSPVVHMVMADIYLLLPPVLNPIVYSVK
TKQIXMIFQVFQRQKK

Protein domains and features

Variations - SNPs

Chr Start End Type Variation AA Change SNP IDs
11 100 -100 SNP T/C 1000GP (YRI, YRI, YRI, YRI, YRI, YRI, YRI, YRI)
11 4,859,662 4,859,662 SNP T/C 1000GP (CEU, CHBJPT)
11 4,859,762 4,859,762 SNP C/G 1000GP (CEU, CHBJPT)
11 4,859,872 4,859,872 SNP G/A 1000GP (CEU)
11 4,880,892 4,880,892 SNP C/T rs11034368 (DbSNP)
11 4,880,992 4,880,992 SNP C/G rs7947547 (DbSNP)
11 4,881,011 4,881,010 Ins(1) -/G rs35010910 (DbSNP)
11 4,881,020 4,881,020 SNP C/T rs61710756 (DbSNP)
11 4,881,079 4,881,079 SNP A/G rs74054606 (DbSNP)
11 4,881,252 4,881,252 SNP A/G rs16906807 (DbSNP)

Variations - CNVs

Chr Start End Type Sources
11 4,878,850 4,881,894 CopyNumber #55 (Waszak)
11 4,880,507 4,889,847 CopyNumber Variation_65846 (DGV)

Haplotypes

Protein haplotypes were calculated using the 1000 genomes project as described in Olender T. et. al. BMC Genomics 2012.