Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

OR51H2P Olfactory Receptor

Gene Symbol OR51H2P1 (View this gene in GeneCards)
Family 51
Subfamily H
Pseudogene Yes
CORP pseudogene probability score
Aliases OR11-18, HsOR11.3.29P, ORL3538
External Ids HGNC: 15199   GeneBank: AB065526, BK004773, NG_004389   ORDB: ORL3538   
Build #39 labels OR51H2P
Chromosomal location 11:4,876,557-4,877,503 (+)
Cluster 11@5
Synteny CLIC#23
Remarks

Most Similar ORs in Humans (Paralogs)

Symbol Percent Length
OR51H1P 62.38% 311

Most Similar ORs in other species (Orthologs)

Specie Symbol Percent Length
Dog OR51H2 83% 317
Chimp CONTIG465.125-26917 96% 317
Mouse Or51h1 68% 310
Rat Or51h1 68% 310
Cow OR51H10P 74% 316

Sequence information

Nucleotide sequence ATGTCACCACTCAACCAAACTACTGAGAACCACCAGAGCTTCTTCACCCTGACTGGGATT
CCAGGAATGCCAGAGAAAGACTTATGGATGGCCTTGCCCCTCTGTCTTCTTTATAGCACC
ACGATCTTGGGAAATGTCACCATCCTTGTTGTCATCAAAGTTGAGCAAAGTCTCCATGAG
CCCATGTATTTTTCTAGCCATGTTAGCTGCCACTGACCTCAGCCTTTCACTGTCTTCCAT
GCCTACCATGGTCAGTGTTCACTGGTTCAACTGGCGTTCAATAACTTTTAATGGCTGCCT
TATCCAGATGTTCTTCATCCACACATTTGGGGGAGTGGAATCAGGTGTTCTGGTGGCCAT
GGCCTTTGATCGCTTTGTGGCCATCCGCTTTCCTTTGCACTATGCTACAATTCTCACTCA
CAGTGTCATCAGCAAGATTGCAGCAGCCATCCTGCTACGGAGTGTGGGGGCTGTGCTCCC
TGTGCCTTTTCTCATCAAAAGGTTACCTTTCTGTCACTCCAATGTCCTCTCCCATGCATA
CTGCCTCCATCAGGATGCCATGAGGCTTGCCTGTGCTGACACTGGTGTCAATAGCATCTA
TGGCCTGTTGGCTGTGATCTTCATCATTGTACTAGATGCCTTAATACTTTTGGCCTCTTA
CATTCTAATCCTGCAGGCAGTATTGAGCATTGCTTCCCAGGAAGACAGGCTCAAGGCTCT
CAACACCTGTCTCTCTCATATCTGCAGTGCTGCTTTTCTATGTGCCTCTCATTGGTATGA
CCCTAATTCATCGCTATGGGAAGCATTTGTCACCACTAATACACACATTCATGGCCAATA
TCTACCTGCTTCTCCCTCCTGTGCTCAATCCCATTGTGTACAGTGTTAGGACCAAGCAGA
TCTGATAGCAGATTGTCCAGGCCTTTTGTGGGGCTAGGGTTAGCCCT
Conceptual translation MSPLNQTTENHQSFFTLTGIPGMPEKDLWMALPLCLLYSTTILGNVTILVVIKVEQSLH\br/>SPCIFLAMLAATDLSLSLSSMPTMVSVHWFNWRSITFNGCLIQMFFIHTFGGVESGVLVA
MAFDRFVAIRFPLHYATILTHSVISKIAAAILLRSVGAVLPVPFLIKRLPFCHSNVLSHA
YCLHQDAMRLACADTGVNSIYGLLAVIFIIVLDALILLASYILILQAVLSIASQEDRLKA
LNTCLSHI\VLLFYVPLIGMTLIHRYGKHLSPLIHTFMANIYLLLPPVLNPIVYSVRTK
QIXQIVQAFCGARVSP

Protein domains and features

Variations - SNPs

Chr Start End Type Variation AA Change SNP IDs
11 100 -100 SNP A/T 1000GP (YRI, YRI, YRI)
11 4,876,750 4,876,750 SNP C/T 1000GP (CEU)
11 4,877,110 4,877,110 SNP G/A 1000GP (CEU)
11 4,897,977 4,897,976 Ins(2) -/AT rs57505631 (DbSNP)
11 4,897,978 4,897,977 Ins(2) -/AT rs35770986 (DbSNP)
11 4,898,377 4,898,377 SNP A/G rs73405009 (DbSNP)
11 4,898,405 4,898,405 Del(1) -/C rs35250828 (DbSNP)

Haplotypes

Protein haplotypes were calculated using the 1000 genomes project as described in Olender T. et. al. BMC Genomics 2012.