Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

OR51I1 Olfactory Receptor

Gene Symbol OR51I11 (View this gene in GeneCards)
Family 51
Subfamily I
Pseudogene No
CORP pseudogene probability score 0.09 (functional)
Aliases OR11-39, HsOR11.3.65, ORL3407
External Ids HGNC: 15200   GeneBank: BK004429, NM_001005288   ORDB: ORL3407   
Build #39 labels OR51I1
Chromosomal location 11:5,440,573-5,441,514 (-)
Cluster 11@5
Synteny CLIC#23
Remarks

Most Similar ORs in Humans (Paralogs)

Symbol Percent Length
OR51I2 61.67% 300

Most Similar ORs in other species (Orthologs)

Specie Symbol Percent Length
Dog OR51I2P 58% 301
Chimp CONTIG465.67-14307 98% 314
Mouse Or51i1 88% 313
Rat Or51i1 88% 313
Cow OR51I1 87% 312

Expression evidences

Source Accession
mRNA BC151148
GNF Atlas2 gnf1h10681_at

Sequence information

Nucleotide sequence ATGCTGGGTCTCAATGGCACCCCCTTCCAGCCAGCAACACTCCAGCTGACAGGCATTCCT
GGGATACAAACAGGCCTCACCTGGGTTGCCCTGATTTTCTGCATCCTCTACATGATCTCC
ATTGTAGGTAACCTCAGCATTCTCACTCTGGTGTTTTGGGAGCCTGCTCTGCATCAGCCC
ATGTACTACTTCCTCTCTATGCTCGCTCTCAATGATCTGGGAGTGTCCTTTTCTACACTT
CCCACTGTGATTTCTACTTTCTGCTTCAACTACAACCATGTTGCGTTTAATGCTTGCCTG
GTCCAGATGTTCTTCATCCACACTTTCTCCTTCATGGAGTCAGGCATACTGCTGGCCATG
AGCTTGGATCGCTTTGTGGCTATTTGTTATCCATTACGCTATGTCACTGTGCTCACTCAC
AACCGTATATTGGCTATGGGTCTGGGCATCCTTACCAAGAGTTTCACCACTCTCTTCCCT
TTCCCTTTTGTGGTGAAACGACTGCCCTTCTGCAAAGGCAATGTTTTGCATCACTCCTAC
TGTCTCCATCCAGATCTCATGAAAGTAGCATGTGGAGACATCCATGTTAACAACATTTAT
GGGCTCTTGGTGATCATTTTTACCTATGGTATGGACTCAACTTTCATCCTGCTTTCCTAC
GCATTGATCCTGAGAGCCATGCTGGTCATCATATCCCAGGAACAGCGGCTCAAGGCACTC
AACACCTGCATGTCACACATCTGTGCAGTGCTGGCCTTTTATGTGCCCATAATTGCTGTC
TCCATGATTCACCGCTTCTGGAAAAGTGCTCCACCTGTTGTTCATGTCATGATGTCCAAT
GTCTACCTGTTTGTACCACCCATGCTCAACCCTATCATCTACAGTGTGAAAACCAAGGAG
ATCCGCAAAGGGATTCTCAAGTTCTTCCATAAATCCCAGGCC
Conceptual translation MLGLNGTPFQPATLQLTGIPGIQTGLTWVALIFCILYMISIVGNLSILTLVFWEPALHQP
MYYFLSMLALNDLGVSFSTLPTVISTFCFNYNHVAFNACLVQMFFIHTFSFMESGILLAM
SLDRFVAICYPLRYVTVLTHNRILAMGLGILTKSFTTLFPFPFVVKRLPFCKGNVLHHSY
CLHPDLMKVACGDIHVNNIYGLLVIIFTYGMDSTFILLSYALILRAMLVIISQEQRLKAL
NTCMSHICAVLAFYVPIIAVSMIHRFWKSAPPVVHVMMSNVYLFVPPMLNPIIYSVKTKE
IRKGILKFFHKSQA

Protein domains and features

Variations - SNPs

Chr Start End Type Variation AA Change SNP IDs
11 100 -100 NS C/G G/A 1000GP (YRI, YRI, YRI, YRI, YRI, YRI, YRI, YRI)
11 100 -100 SYN G/A Y/Y 1000GP (YRI, YRI, YRI)
11 5,440,604 5,440,604 NS C/G G/A 1000GP (CEU, CHBJPT)
11 5,440,631 5,440,631 NS C/G S/T 1000GP (CEU)
11 5,440,761 5,440,761 NS C/A A/S 1000GP (CEU, CHBJPT)
11 5,440,855 5,440,855 SYN G/A Y/Y 1000GP (CEU, CHBJPT)
11 5,440,875 5,440,875 NS T/C T/A 1000GP (CHBJPT)
11 5,441,025 5,441,025 NS C/G V/L 1000GP (CEU, CHBJPT)
11 5,441,144 5,441,144 NS C/T R/H 1000GP (CEU, CHBJPT)
11 5,441,472 5,441,472 nonsense SNP G/A Q/* 1000GP (CEU, CHBJPT)
11 5,461,841 5,461,841 NS A/G C/R rs61736831 (DbSNP)
11 5,461,860 5,461,860 NS C/A R/S rs61735506 (DbSNP)
11 5,461,963 5,461,963 NS G/A S/F rs61737027 (DbSNP)
11 5,461,974 5,461,974 NS C/T M/I rs11037443 (DbSNP)
11 5,461,991 5,461,991 NS A/C S/A rs1498486 (DbSNP)
11 5,462,085 5,462,085 SYN A/G Y/Y rs11037444 (DbSNP)
11 5,462,105 5,462,105 NS C/T A/T rs60832895 (DbSNP)
11 5,462,255 5,462,255 NS C/G V/L rs11037445 (DbSNP)
11 5,462,374 5,462,374 NS C/T R/H rs16930982 (DbSNP)
11 5,462,702 5,462,702 nonsense SNP A/G */Q rs16930998 (DbSNP)

Variations - CNVs

Chr Start End Type Sources
11 5,416,622 5,492,033 CopyNumber Variation_2901 (DGV)
11 5,431,984 5,493,309 CopyNumber Variation_9174 (DGV)
11 5,459,803 5,462,844 CopyNumber #61 (Waszak)

Haplotypes

Protein haplotypes were calculated using the 1000 genomes project as described in Olender T. et. al. BMC Genomics 2012.

G304A S295R S295T F284L S261F A252S R236Q A226D T214A C191R V149L R109H D57E Q15* T7N % Freq CORP
1 G S S F S A R A T C V R D Q T 33.26 0.357
2 G S S F S S R A T C V R D Q T 33.18 0.357
3 G S S F S A R A T C L R D Q T 9.75 0.357
4 A S S F S A R A T C V R D Q T 9.22 0.357
5 G S S F S A R A A C L H D * T 7.76 1.200
6 G S S F S A R A T C L R D Q N 1.69 0.357
7 G S S F S A R A T C L R E Q T 1.31 0.357
8 G S S F S A R A T C L H D * T 1.08 1.200
9 G S S F F A R A T C V R D Q T 0.84 0.357
10 G S T F S S R A T C V R D Q T 0.61 0.357
11 G R S F S S R A T C V R D Q T 0.38 0.357
12 G S S F S A R A T C V H D * T 0.23 1.200
13 G S S F S A Q A T C L R D Q T 0.15 0.357
14 G S S L S A R A T C V R D Q T 0.15 0.357
15 A S S F S S R A T C V R D Q T 0.08 0.357
16 G S S F F A R A A C L H D * T 0.08 1.200
17 G S S F S A R D T C V R D Q T 0.08 0.357
18 G S S F S S R A T C L R D Q T 0.08 0.357
19 G S S F S A R A A R L H D * T 0.08 1.200

AceView Gene Models

The information is based on AceView gene models, constructed from cDNA sequences. The information might be incomplete.

Accession Type Chr Start End Strand
OR51I1.aApr07-unspliced main_exon 3UTR chr11 5,440,570 5,440,573 -
CDS chr11 5,440,573 5,441,514 -