Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

OR51I2 Olfactory Receptor

Gene Symbol OR51I21 (View this gene in GeneCards)
Family 51
Subfamily I
Pseudogene No
CORP pseudogene probability score 0.12 (functional)
Aliases OR11-38, HsOR11.3.66, ORL3305
External Ids HGNC: 15201   GeneBank: BK004381, NM_001004754   ORDB: ORL3305   
Build #39 labels OR51I2
Chromosomal location 11:5,453,489-5,454,424 (+)
Cluster 11@5
Synteny CLIC#23
Remarks

Most Similar ORs in Humans (Paralogs)

Symbol Percent Length
OR51F5P 56.11% 303
OR51G2 58.05% 298
OR51I1 61.67% 300

Most Similar ORs in other species (Orthologs)

Specie Symbol Percent Length
Dog OR51I2P 86% 306
Chimp CONTIG*********** 99% 312
Mouse Or51i2 89% 312
Rat Or51i2 89% 312
Cow OR51I2 89% 312
Cow OR51I2BP 88% 300

Expression evidences

Source Accession
mRNA BC140730
GNF Atlas2 gnf1h05433_at
GNF Atlas2 gnf1h10876_s_at

Sequence information

Nucleotide sequence ATGGGGTTGTTCAATGTCACTCACCCTGCATTCTTCCTCCTGACTGGTATCCCTGGTCTG
GAGAGCTCTCACTCCTGGCTGTCAGGGCCCCTCTGCGTGATGTATGCTGTGGCCCTTGGG
GGAAATACAGTGATCCTGCAGGCTGTGCGAGTGGAGCCCAGCCTCCATGAGCCCATGTAC
TACTTCCTGTCCATGTTGTCCTTCAGTGATGTGGCCATATCCATGGCCACACTGCCCACT
GTACTCCGAACCTTCTGCCTCAATGCCCGCAACATCACTTTTGATGCCTGTCTAATTCAG
ATGTTTCTTATTCACTTCTTCTCCATGATGGAATCAGGTATTCTGCTGGCCATGAGTTTT
GACCGCTATGTGGCCATTTGTGACCCCTTGCGCTATGCAACTGTGCTCACCACTGAAGTC
ATTGCTGCAATGGGTTTAGGTGCAGCTGCTCGAAGCTTCATCACCCTTTTCCCTCTTCCC
TTTCTTATTAAGAGGCTGCCTATCTGCAGATCCAATGTTCTTTCTCACTCCTACTGCCTG
CACCCAGACATGATGAGGCTTGCCTGTGCTGATATCAGTATCAACAGCATCTATGGACTC
TTTGTTCTTGTATCCACCTTTGGCATGGACCTGTTTTTTATCTTCCTCTCCTATGTGCTC
ATTCTGCGTTCTGTCATGGCCACTGCTTCCCGTGAGGAACGCCTCAAAGCTCTCAACACA
TGTGTGTCACATATCCTGGCTGTACTTGCATTTTATGTGCCAATGATTGGGGTCTCCACA
GTGCACCGCTTTGGGAAGCATGTCCCATGCTACATACATGTCCTCATGTCAAATGTGTAC
CTATTTGTGCCTCCTGTGCTCAACCCTCTCATTTATAGCGCCAAGACAAAGGAAATCCGC
CGAGCCATTTTCCGCATGTTTCACCACATCAAAATA
Conceptual translation MGLFNVTHPAFFLLTGIPGLESSHSWLSGPLCVMYAVALGGNTVILQAVRVEPSLHEPMY
YFLSMLSFSDVAISMATLPTVLRTFCLNARNITFDACLIQMFLIHFFSMMESGILLAMSF
DRYVAICDPLRYATVLTTEVIAAMGLGAAARSFITLFPLPFLIKRLPICRSNVLSHSYCL
HPDMMRLACADISINSIYGLFVLVSTFGMDLFFIFLSYVLILRSVMATASREERLKALNT
CVSHILAVLAFYVPMIGVSTVHRFGKHVPCYIHVLMSNVYLFVPPVLNPLIYSAKTKEIR
RAIFRMFHHIKI

Protein domains and features

Variations - SNPs

Chr Start End Type Variation AA Change SNP IDs
11 100 -100 NS T/C M/T 1000GP (YRI, YRI, YRI, YRI, YRI, YRI)
11 100 -100 SYN G/T G/G 1000GP (YRI, YRI)
11 5,453,608 5,453,608 SYN G/T G/G 1000GP (CEU, CHBJPT)
11 5,453,888 5,453,888 NS A/G T/A 1000GP (CEU, CHBJPT)
11 5,453,940 5,453,940 NS G/C R/P 1000GP (CEU, CHBJPT)
11 5,454,275 5,454,275 NS C/T R/C 1000GP (CEU)
11 5,454,276 5,454,276 NS G/A R/H 1000GP (CEU, CHBJPT)
11 5,454,367 5,454,367 SYN C/T S/S 1000GP (CEU, CHBJPT)
11 5,454,385 5,454,385 SYN C/T I/I 1000GP (CHBJPT)
11 5,474,838 5,474,838 SYN G/T G/G rs2030094 (DbSNP)
11 5,474,894 5,474,894 NS C/T T/M rs74049540 (DbSNP)
11 5,475,082 5,475,082 NS C/T R/C rs10450603 (DbSNP)
11 5,475,118 5,475,118 NS A/G T/A rs12577167 (DbSNP)
11 5,475,170 5,475,170 NS C/G P/R rs16931292 (DbSNP)
11 5,475,279 5,475,279 SYN C/T L/L rs10450604 (DbSNP)
11 5,475,432 5,475,431 Ins(2) -/CA rs35301588 (DbSNP)
11 5,475,433 5,475,432 Ins(2) -/CA rs67809969 (DbSNP)
11 5,475,434 5,475,433 Ins(2) -/CA rs71053261 (DbSNP)
11 5,475,506 5,475,506 NS A/G H/R rs11037502 (DbSNP)
11 5,475,597 5,475,597 SYN C/T S/S rs11037503 (DbSNP)

Variations - CNVs

Chr Start End Type Sources
11 5,416,622 5,492,033 CopyNumber Variation_2901 (DGV)
11 5,431,984 5,493,309 CopyNumber Variation_9174 (DGV)

Haplotypes

Protein haplotypes were calculated using the 1000 genomes project as described in Olender T. et. al. BMC Genomics 2012.

M59T R122C T134A R151P R231C R263C R263H % Freq CORP
1 M R T R R R R 56.61 0.138
2 M R A R R R R 15.13 0.138
3 M R T P R R H 13.06 0.138
4 T R T R R R R 6.84 0.572
5 M C T R R R R 4.38 0.741
6 M R T R R R H 1.54 0.138
7 M R T R R C R 1.08 0.138
8 M R T R C R R 0.92 0.138
9 M C T R C R R 0.31 0.741
10 M R T P R R R 0.08 0.138
11 M C T P R R H 0.08 0.741

AceView Gene Models

The information is based on AceView gene models, constructed from cDNA sequences. The information might be incomplete.

Accession Type Chr Start End Strand
OR51I2.aApr07-unspliced main_exon CDS chr11 5,453,489 5,454,424 +
3UTR chr11 5,454,424 5,454,427 +