Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

OR51J1 Olfactory Receptor

Gene Symbol OR51J11 (View this gene in GeneCards)
Family 51
Subfamily J
Pseudogene No
CORP pseudogene probability score
Aliases HsOR11.3.62P
External Ids HGNC: 14856   
Build #39 labels OR51J2, OR51J1P
Chromosomal location 11:5,402,597-5,403,544 (+)
Cluster 11@5
Synteny CLIC#23
Remarks Segregating Pseudo Gene, a nonsynonymous SNP in a highly conserved amino-acid (rs1909261)

Most Similar ORs in Humans (Paralogs)

Symbol Percent Length
OR51A1P 49.17% 301
OR51G1 44.69% 311

Most Similar ORs in other species (Orthologs)

Specie Symbol Percent Length
Dog OR51J3 63% 331
Chimp CONTIG*********** 97% 317
Mouse Or51j3 62% 306
Rat Or51j3 63% 328
Cow OR51J3 59% 331

Expression evidences

Source Accession
ESTs BE170478
mRNA AB529238

Sequence information

Nucleotide sequence ATGAAAATTTCTAATAACTCTTTGGGGTTTTTACCTACGACTTTCATTTTGGTTGGCATC
CCAGGGCTGGAGTCAGAGCACCTCTGGATATCCGTCCCCTTCTCCCTGATATACATCATC
ATTTTCCTTGGGAATGGCATCATTCTTCACGTCATCAGAACAGATATTGCCCTACATCAA
CCCATGTACCTCTTCCTTGCCATGTTGGCACTGGCCGAGGTTCGTGTCTCTGCATCCACC
CTGCCTACAGTGTTAGGCATATTCCTTTTTGGAAATACTGAAATTAGTCTTGAAGCTTGT
CTTTTTCCAGATGTTCTCCATCCATTCTTTATCCATGATGGAGCCAGCTGTGCTGCTGGC
CATGTCTTTGGACCGCTTTATAGCCATCTACAGCCCACTGAGCTACACAGCTATCCTGAC
ACTGCCCAGGGTCTTTGGCACAGGAGCTATTATCGTACTGAAAAGCATTATGCTCATGGC
TCCGTTGCCCATTCTCTTATGGCGTCTGCCCTTCTGTGGCCACAATGCCCTCTCACATTC
CTATTGTCTGCACCCCAATCTTATCTATCTTGTGGGAACATTTCTGTTAACAATATCTAT
GGGATTTTCATTGTTACCTCTACTTTTGGGCTGGATTCGTTGCTGATTGTGATCTCCTAT
GGGCTCATACTCCACACTGTATTGGGTATTGCCACTGGAGAAGGGAGGAAGAAGGCACTC
AACACATGTGGCTCACACGTCTGTGCTGTGCTTGCTTACTATGTGCCTATGATTGGCTTG
TCTATAGTGCACCGCCTTGGACATCGTGTGTCCCCTCTGCTGCAAGCCATGATGGCCAAT
GCCTACCTCTTCTTCCCACCTGTTGTCAATCCTATTGTCTACAGCATTAAGACCAAGGAG
ATCCATGGTGCCATTGTCCGAATGCTATTAGAGAAAAGACGCAGAGTG
Conceptual translation MKISNNSLGFLPTTFILVGIPGLESEHLWISVPFSLIYIIIFLGNGIILHVIRTDIALHQ
PMYLFLAMLALAEVRVSASTLPTVLGIFLFGNTEISLEACLFPDVLHPFFIHDGASCAAG
HVFGPLYSHLQPTELHSYPDTAQGLWHRSYYRTEKHYAHGSVAHSLMASALLWPQCPLTF
LLSAPQSYLSCGNISVNNIYGIFIVTSTFGLDSLLIVISYGLILHTVLGIATGEGRKKAL
NTCGSHVCAVLAYYVPMIGLSIVHRLGHRVSPLLQAMMANAYLFFPPVVNPIVYSIKTKE
IHGAIVRMLLEKRRRV

Protein domains and features

Variations - SNPs

Chr Start End Type Variation AA Change SNP IDs
11 100 -100 NS A/T N/I 1000GP (YRI, YRI, YRI, YRI, YRI, YRI, YRI, YRI)
11 100 -100 SYN T/A T/T 1000GP (YRI, YRI, YRI, YRI, YRI, YRI)
11 5,402,638 5,402,638 SYN T/A T/T 1000GP (CEU, CHBJPT)
11 5,402,701 5,402,701 SYN C/T S/S 1000GP (CEU, CHBJPT)
11 5,402,747 5,402,747 NS G/A V/I 1000GP (CEU)
11 5,402,820 5,402,820 NS G/A R/H 1000GP (CEU, CHBJPT)
11 5,402,895 5,402,895 NS G/A C/Y 1000GP (CEU, CHBJPT)
11 5,402,940 5,402,940 NS C/T A/V 1000GP (CEU, CHBJPT)
11 5,403,002 5,403,002 NS C/T H/Y 1000GP (CEU, CHBJPT)
11 5,403,200 5,403,200 NS A/G I/V 1000GP (CEU)
11 5,403,274 5,403,274 SYN T/C T/T 1000GP (CEU, CHBJPT)
11 5,403,277 5,403,277 SYN A/G V/V 1000GP (CEU, CHBJPT)
11 5,403,302 5,403,302 SYN A/C R/R 1000GP (CEU, CHBJPT)
11 5,403,322 5,403,322 SYN A/G T/T 1000GP (CEU, CHBJPT)
11 5,403,364 5,403,364 SYN T/A P/P 1000GP (CHBJPT)
11 5,403,471 5,403,471 NS T/C I/T 1000GP (CEU, CHBJPT)
11 5,423,868 5,423,868 SYN A/T T/T rs2647583 (DbSNP)
11 5,423,931 5,423,931 SYN T/C S/S rs2736526 (DbSNP)
11 5,424,041 5,424,040 Ins(1) -/C rs34397899 (DbSNP)
11 5,424,050 5,424,050 NS G/A R/H rs1909262 (DbSNP)
11 5,424,125 5,424,125 NS G/A C/Y rs1909261 (DbSNP)
11 5,424,170 5,424,170 NS T/C V/A rs2647582 (DbSNP)
11 5,424,232 5,424,232 NS T/C Y/H rs1909260 (DbSNP)
11 5,424,389 5,424,388 Ins(4) -/TATC rs72114742 (DbSNP)
11 5,424,397 5,424,396 Ins(4) -/ATCT rs61459896 (DbSNP)
11 5,424,398 5,424,397 Ins(4) -/ATCT rs34058308 (DbSNP)
11 5,424,430 5,424,430 NS A/G I/V rs7929412 (DbSNP)
11 5,424,504 5,424,504 SYN C/T T/T rs872163 (DbSNP)
11 5,424,507 5,424,507 SYN A/G V/V rs872164 (DbSNP)
11 5,424,532 5,424,532 SYN A/C R/R rs872165 (DbSNP)
11 5,424,552 5,424,552 SYN A/G T/T rs872166 (DbSNP)
11 5,424,701 5,424,701 NS C/T T/I rs16930511 (DbSNP)

Variations - CNVs

Chr Start End Type Sources
11 5,416,622 5,492,033 CopyNumber Variation_2901 (DGV)

Haplotypes

Protein haplotypes were calculated using the 1000 genomes project as described in Olender T. et. al. BMC Genomics 2012.

N6I V18A V51I A72D R75H C100Y A115V H136Y T141S S165F N198S I202V I292T % Freq CORP
1 N V V A R C A H T S N I I 47.08 1.000
2 N V V A R Y V Y T S N I I 17.20 1.000
3 N V V A H C A H T S N I I 14.52 1.000
4 N V V A H C A H T S N V I 9.14 1.000
5 N V V A H C A H T S N I T 7.53 1.000
6 N V V D R C A H T S N I I 2.61 1.000
7 I V V A R Y V Y T S N I I 0.77 1.000
8 N V I A H C A H T S N I T 0.31 1.000
9 N V V A H C V Y T S N I I 0.15 1.000
10 N V I A R C A H T S N I I 0.15 1.000
11 N V V A H C A H T F N I I 0.15 1.000
12 N V V A R Y V H T S N I I 0.08 1.000
13 N A V A H C A H T S N I I 0.08 1.000
14 N V V A H C A H T S S I I 0.08 1.000
15 N V V A R Y V Y S S N I I 0.08 1.000
16 N V V A R Y A Y T S N I I 0.08 1.000