Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

OR51M1 Olfactory Receptor

Gene Symbol OR51M11 (View this gene in GeneCards)
Family 51
Subfamily M
Pseudogene No
CORP pseudogene probability score
Aliases HsOR11.3.61, ORL3291
External Ids HGNC: 14847   ORDB: ORL3291   
Build #39 labels OR51M1
Chromosomal location 11:5,389,432-5,390,376 (+)
Cluster 11@5
Synteny CLIC#23
Remarks

Most Similar ORs in Humans (Paralogs)

Symbol Percent Length
OR51F5P 52.81% 303
OR51G1 54.1% 305
OR51G2 54.64% 291

Most Similar ORs in other species (Orthologs)

Specie Symbol Percent Length
Dog OR51M1 84% 314
Chimp CONTIG465.73-10579 97% 315
Mouse Or51m1 84% 315
Rat Or51m1 83% 251
Cow OR51M1 85% 309
Cow OR51M1BP 82% 308

Expression evidences

Source Accession
mRNA BC136913

Sequence information

Nucleotide sequence ATGCTGCTATCCAACATTACTCAGTTTAGCCCCATATTCTATCTCACCAGCTTTCCTGGA
TTGGAAGGCATCAAACACTGGATTTTCATCCCCTTTTTCTTTATGTACATGGTTGCCATC
TCAGGCAATTGTTTCATTCTGATCATTATTAAGACCAACCCTCGTCTGCACACACCCATG
TACTATCTACTATCCTTGCTGGCCCTCACTGACCTGGGGCTGTGTGTGTCCACGTTGCCC
ACCACTATGGGGATCTTCTGGTTTAACTCCCATAGTATCTACTTTGGAGCGTGTCAAATC
CAGATGTTCTGCATCCACTCTTTTTCCTTCATGGAGTCCTCAGTGCTCCTCATGATGTCC
TTTGACCGCCTTGTGGCCATCTGCCACCCTCTGAGGTATTCGGTCATTATCACTGGCCAG
CAAGTGGTCAGAGCAGGCCTAATTGTCATCTTCCGGGGACCTGTGGCCACTATCCCTATT
GTCCTCCTCCTGAAGGCTTTTCCCTACTGTGGATCTGTGGTCCTCTCCCACTCATTTTGC
CTGCACCAGGAAGTGATACAGCTGGCCTGCACAGATATCACCTTCAATAATCTGTATGGA
CTGATGGTGGTAGTTTTCACTGTGATGCTGGACCTGGTGCTCATCGCACTGTCCTATGGA
CTCATCCTGCACACAGTAGCAGGCCTGGCCTCCCAAGAGGAGCAGCGCCGTGCCTTTCAG
ACATGCACCGCTCCTCTCTGTGCTGTGCTAGTATTCTTTGTGCCCATGATGGGGCTGTCC
CTGGTGCACCGTTTTGGGAAGCATGCCCCACCTGCTATTCATCTTCTTATGGCCAATGTC
TACCTTTTTGTGCCTCCCATGCTTAACCCAATCATATACAGCATTAAGACCAAGGAGATC
CACCGTGCCATTATCAAGTTCCTAGGTCTTAAAAAGGCCAGTAAA
Conceptual translation MLLSNITQFSPIFYLTSFPGLEGIKHWIFIPFFFMYMVAISGNCFILIIIKTNPRLHTPM
YYLLSLLALTDLGLCVSTLPTTMGIFWFNSHSIYFGACQIQMFCIHSFSFMESSVLLMMS
FDRLVAICHPLRYSVIITGQQVVRAGLIVIFRGPVATIPIVLLLKAFPYCGSVVLSHSFC
LHQEVIQLACTDITFNNLYGLMVVVFTVMLDLVLIALSYGLILHTVAGLASQEEQRRAFQ
TCTAPLCAVLVFFVPMMGLSLVHRFGKHAPPAIHLLMANVYLFVPPMLNPIIYSIKTKEI
HRAIIKFLGLKKASK

Protein domains and features

Variations - SNPs

Chr Start End Type Variation AA Change SNP IDs
11 100 -100 NS C/A N/K 1000GP (YRI, YRI, YRI, YRI, YRI, YRI, YRI, YRI, YRI)
11 100 -100 SYN G/A K/K 1000GP (YRI)
11 5,389,704 5,389,704 NS T/G H/Q 1000GP (CEU, CHBJPT)
11 5,389,801 5,389,801 NS C/T L/F 1000GP (CEU, CHBJPT)
11 5,390,009 5,390,009 NS T/C I/T 1000GP (CEU, CHBJPT)
11 5,390,160 5,390,160 SYN C/T T/T 1000GP (CHBJPT)
11 5,390,165 5,390,165 NS C/A P/H 1000GP (CEU, CHBJPT)
11 5,390,168 5,390,168 NS T/G L/R 1000GP (CEU, CHBJPT)
11 5,390,243 5,390,243 NS C/A P/H 1000GP (CEU)
11 5,390,349 5,390,349 SYN G/A K/K 1000GP (CEU, CHBJPT)
11 5,390,350 5,390,350 NS T/C F/L 1000GP (CEU, CHBJPT)
11 5,410,934 5,410,934 NS G/T Q/H rs1498467 (DbSNP)
11 5,411,031 5,411,031 NS C/T L/F rs1498468 (DbSNP)
11 5,411,239 5,411,239 NS C/T T/I rs1498469 (DbSNP)
11 5,411,395 5,411,395 NS A/C H/P rs9783355 (DbSNP)
11 5,411,398 5,411,398 NS T/G L/R rs2736531 (DbSNP)
11 5,411,579 5,411,579 In-Del(1) T/GT rs10768906 (DbSNP)
11 5,411,579 5,411,579 SYN A/G K/K rs57901682 (DbSNP)
11 5,411,580 5,411,580 NS C/T L/F rs10768907 (DbSNP)

Variations - CNVs

Chr Start End Type Sources
11 5,409,794 5,412,609 CopyNumber Variation_71261 (DGV)

Haplotypes

Protein haplotypes were calculated using the 1000 genomes project as described in Olender T. et. al. BMC Genomics 2012.

N16K H102Q R134C P165L I204T F318L % Freq CORP
1 N Q R P T L 69.28 0.092
2 N H R P I F 25.81 0.092
3 K H R P I F 2.69 0.092
4 N H C L T L 1.54 0.092
5 N Q R P T F 0.46 0.092
6 N Q C P T L 0.15 0.092
7 N Q R P I L 0.08 0.092

AceView Gene Models

The information is based on AceView gene models, constructed from cDNA sequences. The information might be incomplete.

Accession Type Chr Start End Strand
OR51M1.aApr07-unspliced main_exon 5UTR chr11 5,389,399 5,389,432 +
CDS chr11 5,389,432 5,390,376 +
3UTR chr11 5,390,376 5,390,379 +