Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

OR51N1P Olfactory Receptor

Gene Symbol OR51N1P1 (View this gene in GeneCards)
Family 51
Subfamily N
Pseudogene Yes
CORP pseudogene probability score
Aliases OR11-20, HsOR11.3.23P, ORL3486
External Ids HGNC: 14757   GeneBank: AB065528, BK004770, NG_004281   ORDB: ORL3486   
Build #39 labels OR51N1P
Chromosomal location 11:4,786,754-4,787,702 (+)
Cluster 11@5
Synteny CLIC#23
Remarks

Most Similar ORs in Humans (Paralogs)

Symbol Percent Length
OR51F1 58.79% 313
OR51F2 57.91% 316
OR51F5P 56.55% 313

Most Similar ORs in other species (Orthologs)

Specie Symbol Percent Length
Dog OR51F1 62% 317
Chimp CONTIG465.134-2796 97% 317
Mouse Or51f1 61% 310
Rat Or51f1 60% 310
Cow OR51F1B 61% 313

Sequence information

Nucleotide sequence ATGCCACACCTCAGCAACACCACATCTGAGTTCCCAATCTTCCTCCTAACAGGCTTCCCT
GGGCTGGAGGCCTTCCACATCTGGATCTCAATTCCCTTCTTCCTTCTGAGCACAGTTGCT
CTCTTAGGGAACAGCATGATCCTATTGGTTGTTATTCTGGAGCCAAACCTCCATGAACCC
ATGTACTGTTTTCTCTTCATGCTGTCTGCCGCTGACCTGGGGCTGACCCTCTCCACAATG
CCCACGACCCTCAGTGTCCTCTGGTTCAGTGCACGTGAAATCATCCTCAATGCATGTATC
ATCCAGCTCTTTTTCCTCCACAGCTCTGGCTTTATGGAATCCTCAGTACTGATGGCCATG
GCTTTTGACCGCTTTGTTGCCATTTGCAGACCCCTCAGATATGCTACCATCCTGACAGAC
TCCAGAATTCTAAAGATTGGTGTAGCAATAGTCCTAAGAACATTGATCAGCCTCTGTCCA
TCCCTCTTTCTCATTAAGAGACTGTCATTTTGCAAAGTCAATGTCCTTTCCCATTCTTAC
TGCTTCCACCCTGATGCGCTTAAAGTTGCATGTTCTGATTCAAGGATGAACAGCTATGGA
GGCTTAGCTGTTCTCATTCTGGTCACCGGGGTTGGTACACCATGTGTTGCGCTTTCCTAC
ATCCTGATAATCCACTCTGTACTAAACATCATCTCTTCAGAGGGACGGAGGAAGGCCTTC
GACACTTGTGGATCTCACATTGGGGCAGTTGCAGTCTTCTACATTCCCTGGGTTGTTCTT
TCAGTTGTCCACAGATTTTTCCACAAGGCTTCACCAATATGTCCACCCACTATTGTCCAA
CATCTATTTCCTTGGCCCCTCTCGGCTGAACCCCATCATATATAGTGTGAAGACTAAACA
AATCCGCAGGGCTATCCTCAAACTCTTTCAAACAAAATCAAAAGAAATG
Conceptual translation MPHLSNTTSEFPIFLLTGFPGLEAFHIWISIPFFLLSTVALLGNSMILLVVILEPNLHEP
MYCFLFMLSAADLGLTLSTMPTTLSVLWFSAREIILNACIIQLFFLHSSGFMESSVLMAM
AFDRFVAICRPLRYATILTDSRILKIGVAIVLRTLISLCPSLFLIKRLSFCKVNVLSHSY
CFHPDALKVACSDSRMNSYGGLAVLILVTGVGTPCVALSYILIIHSVLNIISSEGRRKAF
DTCGSHIGAVAVFYIPWV/SFSCP/DFSTRLHQYVHPLLSNIYFLGPSRLNPIIYSVK
TKQIRRAILKLFQTKSKEM

Protein domains and features

Variations - SNPs

Chr Start End Type Variation AA Change SNP IDs
11 4,808,214 4,808,214 SNP A/C rs34775015 (DbSNP)
11 4,808,289 4,808,289 SNP A/G rs11033880 (DbSNP)
11 4,808,098 4,808,098 SNP A/G rs34012768 (DbSNP)
11 4,808,227 4,808,227 SNP A/G rs11033879 (DbSNP)
11 4,808,425 4,808,425 SNP A/G rs17227978 (DbSNP)
11 4,808,459 4,808,459 SNP C/G rs16938620 (DbSNP)
11 4,808,532 4,808,532 SNP C/T rs34231378 (DbSNP)
11 4,808,307 4,808,307 SNP C/T rs17227928 (DbSNP)
11 4,808,689 4,808,689 SNP C/T rs73401035 (DbSNP)
11 4,808,133 4,808,133 SNP C/T rs17325567 (DbSNP)
11 4,786,868 4,786,868 SNP G/A 1000GP (CEU)
11 4,786,903 4,786,903 SNP T/C 1000GP (CEU)
11 4,786,984 4,786,984 SNP C/A 1000GP (CEU)
11 4,786,997 4,786,997 SNP A/G 1000GP (CEU)
11 4,787,077 4,787,077 SNP C/T 1000GP (CEU)
11 4,787,195 4,787,195 SNP G/A 1000GP (CEU)
11 4,787,302 4,787,302 SNP C/T 1000GP (CEU)
11 4,787,311 4,787,311 SNP G/A 1000GP (CEU)
11 4,786,964 4,786,964 SNP G/A 1000GP (CHBJPT)
11 100 -100 SNP G/A 1000GP (YRI, YRI, YRI)

Haplotypes

Protein haplotypes were calculated using the 1000 genomes project as described in Olender T. et. al. BMC Genomics 2012.