Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

OR51P1P Olfactory Receptor

Gene Symbol OR51P1P1 (View this gene in GeneCards)
Family 51
Subfamily P
Pseudogene Yes
CORP pseudogene probability score
Aliases HsOR11.3.41P, ORL3488
External Ids HGNC: 14762   ORDB: ORL3488   
Build #39 labels OR51P2P, OR51P1P
Chromosomal location 11:5,015,138-5,016,076 (+)
Cluster 11@5
Synteny CLIC#23
Remarks

Most Similar ORs in Humans (Paralogs)

Symbol Percent Length
OR51G1 52.77% 307
OR51G2 57.89% 304
OR51L1 54.93% 304

Most Similar ORs in other species (Orthologs)

Specie Symbol Percent Length
Dog OR51P1 90% 312
Chimp CONTIG465.112-22378 97% 310
Mouse Or51p1 88% 313
Rat Or51p1 89% 313
Cow OR51P1P 89% 301

Sequence information

Nucleotide sequence ATGTCTGTCTTCAATACTTCTGCCTTATACCCTCGCTTCCTCCTAACGGGCCTCTCAGGC
CTTGAAAGCAGATATGACTTGATTTCCCTGCCCATCTTCTTGGTTTATGCCACCTCAATT
GCCGGGAACATTAGCATCCTCTTCATTATCAGAACTGAGTCTTCCCTCCACCAACCGATG
TATTACTTTCTGTCAATGCTGGCATTCACTGACCTGGGCCTATCTAACACTACCTTACCT
ACCATGTTCAGTGTCTTCTGGTTCCATGCCCGGGAGATCTCCTTCAATGCTTGTCTGGTC
CAAATGTACTTCATTCATGTTTTCTCGATTATTGAGTCAGCTGTACTCCTGGCTATGGCC
TTTGACTGCTTTATAGCAATCTGAGAACCCTTGCGCTATGCAGCCATCCTAACCAATGAT
GTAATCATTGGGATTGGGTTGGCAATTGCTGGAAGGGCCTTGGCTCTGGTCTTTCCAGCT
TCTTTCCTCTTGAAGAGGCTTCAATATCATGATGTCAATATTCTGTCCTACCCCTTCTGC
CTGCACCAGGACCTCATAAAGACGACTGTATCCAACTGTCGAGTCAGCAGCATCTATGGC
CTCATGGTGGTCATCTGTTCCATGGGACTTGATTCAGTGCTTCTCCTCCTCTCCTATGTC
CTCATCCTGGGCACAGTGTTGAGTATAGCCTCCAAGGCAGAGAGAGTGAGAGCCCTCAAT
ACTTGCATCTCCCACATCTGTGCTGTACTCACCTTCTATACACCAATGATTGGGCTATCT
ATGATCCATCGCTATGGACAGAATGCTTCCTCAATTGTCCATGTGCTGATGGCCAATGTC
TACTTGCTGGTTCCACCTCTCATGAACCCCGTTGTCTACAGTGTTAAGACCAAGCAGATT
CGTGACAGAATCTTCAATAAATTCAAGAAACATGAAGTG
Conceptual translation MSVFNTSALYPRFLLTGLSGLESRYDLISLPIFLVYATSIAGNISILFIIRTESSLHQPM
YYFLSMLAFTDLGLSNTTLPTMFSVFWFHAREISFNACLVQMYFIHVFSIIESAVLLAMA
FDCFIAIXPLRYAAILTNDVIIGIGLAIAGRALALVFPASFLLKRLQYHDVNILSYPFC
LHQDLIKTTVSNCRVSSIYGLMVVICSMGLDSVLLLLSYVLILGTVLSIASKAERVRALN
TCISHICAVLTFYTPMIGLSMIHRYGQNASSIVHVLMANVYLLVPPLMNPVVYSVKTKQI
RDRIFNKFKKHEV

Protein domains and features

Variations - SNPs

Chr Start End Type Variation AA Change SNP IDs
11 100 -100 SNP A/G 1000GP (YRI, YRI, YRI, YRI, YRI, YRI, YRI, YRI, YRI)
11 5,015,154 5,015,154 SNP C/G 1000GP (CEU, CHBJPT)
11 5,015,615 5,015,615 SNP G/C 1000GP (CEU)
11 5,015,636 5,015,636 SNP C/T 1000GP (CEU)
11 5,015,670 5,015,670 SNP C/T 1000GP (CEU, CHBJPT)
11 5,015,835 5,015,835 SNP C/A 1000GP (CEU, CHBJPT)
11 5,036,384 5,036,384 SNP C/G rs2499957 (DbSNP)
11 5,036,488 5,036,487 Ins(1) -/T rs36049903 (DbSNP)
11 5,036,761 5,036,761 SNP C/T rs74049425 (DbSNP)
11 5,036,845 5,036,845 SNP C/G rs16908492 (DbSNP)
11 5,036,900 5,036,900 SNP T/C rs2442410 (DbSNP)
11 5,037,065 5,037,065 SNP A/C rs17342537 (DbSNP)
11 5,037,238 5,037,238 SNP A/G rs74049426 (DbSNP)

Variations - CNVs

Chr Start End Type Sources
CopyNumber 93 (Hasin)
11 4,907,893 5,135,331 CopyNumber Variation_3835 (DGV)

Haplotypes

Protein haplotypes were calculated using the 1000 genomes project as described in Olender T. et. al. BMC Genomics 2012.