Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

OR51Q1 Olfactory Receptor

Gene Symbol OR51Q11 (View this gene in GeneCards)
Family 51
Subfamily Q
Pseudogene No
CORP pseudogene probability score
Aliases HsOR11.3.63, ORL3380
External Ids HGNC: 14851   GeneBank: NM_001004757   ORDB: ORL3380   
Build #39 labels OR51Q1
Chromosomal location 11:5,422,201-5,423,151 (+)
Cluster 11@5
Synteny CLIC#23
Remarks Segregating Pseudo Gene, a nonsynonymous SNP rs2647574 (AA change=R/* )

Most Similar ORs in Humans (Paralogs)

Symbol Percent Length
OR51G2 58.48% 289

Most Similar ORs in other species (Orthologs)

Specie Symbol Percent Length
Dog OR51Q1F 84% 315
Dog OR51Q1 84% 314
Chimp CONTIG*********** 96% 317
Mouse Or51q1 84% 315
Mouse Or51q1c 83% 315
Mouse Or51q1b-ps 80% 315
Rat Or51q1e 85% 315
Rat Or51q1 83% 315
Rat Or51q1d 83% 315
Cow OR51Q1 80% 317

Expression evidences

Source Accession
ESTs AV732431
mRNA BC136999

Sequence information

Nucleotide sequence ATGTCCCAGGTGACTAACACCACACAAGAAGGCATCTACTTCATCCTCACGGACATCCCT
GGATTTGAGGCCTCCCACATCTGGATCTCCATCCCCGTCTGCTGTCTCTACACCATCTCC
ATCATGGGCAATACCACCATCCTCACTGTCATTCGCACAGAGCCATCTGTCCACCAGCGC
ATGTATCTGTTTCTCTCCATGCTGGCCCTGACGGACCTGGGTCTCACCCTCACCACCCTA
CCCACAGTCATGCAGCTTCTCTGGTTCAACGTTCGTAGAATCAGCTCTGAGGCCTGTTTT
GCTCAGTTTTTCTTCCTTCATGGATTCTCCTTTATGGAGTCTTCTGTCCTCCTGGCTATG
TCCGTTGACTGCTATGTGGCCATCTGCTGTCCCCTCCATTATGCCTCCATCCTCACCAAT
GAAGTCATTGGTAGAACTGGGTTAGCCATCATTTGCTGCTGTGTTCTGGCGGTTCTTCCC
TCCCTTTTCTTACTCAAGCGACTGCCTTTCTGCCACTCCCACCTTCTCTCTCGCTCCTAT
TGCCTCCACCAGGATATGATCCGCCTGGTCTGTGCTGACATCAGGCTCAACAGCTGGTAT
GGATTTGCTCTTGCCTTGCTCATTATTATCGTGGATCCTCTGCTCATTGTGATCTCCTAT
ACACTTATTCTGAAAAATATCTTGGGCACAGCCACCTGGGCTGAGCGACTCCGTGCCCTC
AATAACTGCCTGTCCCACATTCTAGCTGTCCTGGTCCTCTACATTCCCATGGTTGGTGTA
TCTATGACTCATCGCTTTGCCAAGCATGCCTCTCCACTGGTCCATGTTATCATGGCCAAT
ATCTACCTGCTGGCACCCCCGGTGATGAACCCCATCATTTACAGTGTAAAGAACAAGCAG
ATCCAATGGGGAATGTTAAATTTCCTTTCCCTCAAAAATATGCATTCAAGA
Conceptual translation MSQVTNTTQEGIYFILTDIPGFEASHIWISIPVCCLYTISIMGNTTILTVIRTEPSVHQR
MYLFLSMLALTDLGLTLTTLPTVMQLLWFNVRRISSEACFAQFFFLHGFSFMESSVLLAM
SVDCYVAICCPLHYASILTNEVIGRTGLAIICCCVLAVLPSLFLLKRLPFCHSHLLSRSY
CLHQDMIRLVCADIRLNSWYGFALALLIIIVDPLLIVISYTLILKNILGTATWAERLRAL
NNCLSHILAVLVLYIPMVGVSMTHRFAKHASPLVHVIMANIYLLAPPVMNPIIYSVKNKQ
IQWGMLNFLSLKNMHSR

Protein domains and features

Variations - SNPs

Chr Start End Type Variation AA Change SNP IDs
11 100 -100 nonsense SNP C/T R/* 1000GP (YRI)
11 100 -100 NS C/T T/I 1000GP (YRI, YRI, YRI, YRI, YRI, YRI, YRI, YRI)
11 100 -100 SYN G/C V/V 1000GP (YRI, YRI, YRI, YRI)
11 5,422,212 5,422,212 SYN G/C V/V 1000GP (CEU, CHBJPT)
11 5,422,401 5,422,401 NS G/T M/I 1000GP (CEU)
11 5,422,470 5,422,470 SYN C/T N/N 1000GP (CEU, CHBJPT)
11 5,422,500 5,422,500 SYN T/C F/F 1000GP (CEU)
11 5,422,509 5,422,509 SYN T/C F/F 1000GP (CEU, CHBJPT)
11 5,422,637 5,422,637 NS C/T T/I 1000GP (CEU, CHBJPT)
11 5,422,657 5,422,657 NS T/C C/R 1000GP (CEU, CHBJPT)
11 5,422,663 5,422,663 NS G/A V/I 1000GP (CEU, CHBJPT)
11 5,422,733 5,422,733 NS G/A R/H 1000GP (CEU, CHBJPT)
11 5,422,739 5,422,739 NS A/C Y/S 1000GP (CEU, CHBJPT)
11 5,422,810 5,422,810 NS C/T L/F 1000GP (CHBJPT)
11 5,422,831 5,422,831 NS G/A V/M 1000GP (CEU, CHBJPT)
11 5,422,906 5,422,906 nonsense SNP C/T R/* 1000GP (CEU, CHBJPT)
11 5,422,920 5,422,920 SYN C/T L/L 1000GP (CEU)
11 5,423,123 5,423,123 NS T/C F/S 1000GP (CEU, CHBJPT)
11 5,443,442 5,443,442 SYN C/G V/V rs2736590 (DbSNP)
11 5,443,643 5,443,643 SYN G/A T/T rs2736589 (DbSNP)
11 5,443,700 5,443,700 SYN T/C N/N rs2736588 (DbSNP)
11 5,443,739 5,443,739 SYN T/C F/F rs2736587 (DbSNP)
11 5,443,867 5,443,867 NS C/T T/I rs10838092 (DbSNP)
11 5,443,887 5,443,887 NS C/T R/C rs10838093 (DbSNP)
11 5,443,893 5,443,893 NS A/G I/V rs10838094 (DbSNP)
11 5,443,963 5,443,963 NS A/G H/R rs10838095 (DbSNP)
11 5,443,969 5,443,969 NS A/C Y/S rs58283839 (DbSNP)
11 5,444,061 5,444,061 NS G/A V/M rs2736586 (DbSNP)
11 5,444,136 5,444,136 nonsense SNP T/C */R rs2647574 (DbSNP)
11 5,444,338 5,444,337 Ins(1) -/G rs35273709 (DbSNP)
11 5,444,353 5,444,353 NS T/C F/S rs2647573 (DbSNP)

Variations - CNVs

Chr Start End Type Sources
CopyNumber 96 (Hasin)
11 5,416,622 5,492,033 CopyNumber Variation_2901 (DGV)
11 5,431,984 5,493,309 CopyNumber Variation_9174 (DGV)
11 5,443,331 5,446,381 Deletion #199 (Waszak)

Haplotypes

Protein haplotypes were calculated using the 1000 genomes project as described in Olender T. et. al. BMC Genomics 2012.

M67I T146I C153R V155I R178H R188H L204F V211M S219F R236* R265H F308S % Freq CORP
1 M T C V R R L V S R R F 53.30 0.992
2 M I R I H R L M S * R S 41.55 1.200
3 M T C V R R F V S R R F 1.69 0.992
4 M T C V R R L V F R R F 1.00 0.997
5 M I R I H R L M S * R F 0.38 1.200
6 M T C V H R L M S * R S 0.31 1.200
7 M I R I H R L V S * R S 0.31 1.200
8 M I C V H R L M S * R S 0.23 1.200
9 M T C V R R L V S R H F 0.15 0.992
10 M T C V R H L V S R R F 0.15 0.992
11 M T C V R R L V S * R F 0.15 1.200
12 M T C V R R F M S R R F 0.15 0.992
13 I T C V R R L V S R R F 0.08 0.992
14 M T C I H R L M S * R S 0.08 1.200
15 M I R I R R L M S * R S 0.08 1.200
16 M T C V R R F V S R R S 0.08 0.992
17 M T C V R R L M S R R F 0.08 0.992
18 M I R I H H L M S * R S 0.08 1.200
19 M I R I H R L V S * R F 0.08 1.200
20 M I C V R R L V S R R F 0.08 0.992

AceView Gene Models

The information is based on AceView gene models, constructed from cDNA sequences. The information might be incomplete.

Accession Type Chr Start End Strand
OR51Q1.aApr07-unspliced main_exon CDS chr11 5,422,201 5,423,151 +
3UTR chr11 5,423,151 5,423,154 +