Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

OR51R1P Olfactory Receptor

Gene Symbol OR51R1P1 (View this gene in GeneCards)
Family 51
Subfamily R
Pseudogene Yes
CORP pseudogene probability score
Aliases OR11-6, HsOR11.3.4P, ORL3442
External Ids HGNC: 15203   GeneBank: BK004736, NG_004318   ORDB: ORL3442   
Build #39 labels OR51R1P
Chromosomal location 11:4,418,060-4,419,008 (+)
Cluster 11@5
Synteny CLIC#23
Remarks

Most Similar ORs in Humans (Paralogs)

Symbol Percent Length
OR51F5P 49.68% 316
OR51G2 50.65% 306
OR51H1P 45.86% 314

Most Similar ORs in other species (Orthologs)

Specie Symbol Percent Length
Dog OR51R1 83% 315
Chimp CONTIG465.165-3394 96% 317
Mouse Or51r1 84% 312
Rat Or51r1 83% 313
Cow OR51R1 83% 315

Sequence information

Nucleotide sequence ATGTTCTCCTGCAACACCAGCACTTCTGGTCAGTCTACCTTCCTCCTCACTGGTTTTCCA
GGCCTGGAAGCCTCTCATCATTGGGTTTCCATCCCCATCAACCTCTTCTGTGTGGTTTCC
ATCCTGGGTAATAATATCATCCTCTTCCTGATCCACACAGATCCAGCCTTACATGAACCC
ATGTATATCTTCCTGTCCATGTTGGCAGCCTCTGATCTGGGCCTCTGTGCCTCTACCTTC
CCCACTATGGTGCGTCTCTTCTGGCTGGGAGCTCGTGAGCTGCCCTTTGATCTCTGTGCA
GCACAGATGTTCTTCATCCATACCTTCACCTATGTGGAGTCCGGTGTACTGCTGGCCATG
GCCTTCGATCGCTTTATTGCCATCCGGGACCCTCTGCATTATGCCATAATCATTACCTGC
TCAGTCACAGCCGAGGTGGGAACTGCCATTCTGGTGAGGGCTGTTCTGCTCAACCTCCCG
GGACCTATCCTCCTGCAGCAGCTGCTCTTTCCCAAGATCAGCGCTCTCTGTCACTGCTAC
TGCCTGCACTGTGACCTTGTGGGGTTGGCCTGCTCAGACACCCAGATCAATAGCCTGGTT
GGCCTGGTTTCCATCCTCTTCTCACTGTGCCTTGACTCCTTCCTCATCATGCTTTCATAT
GCCCTGATCCTATGAACTGTGCTGGGCATTGCATCACCTGGGGAGCGGCTCAAGGCACTC
AACACGTGTGTCTCACACCTCTGCATTGTTCTCATCTTTTATTTGCCCAAACGGGCTGTC
TGTCTTGCACCGAGTAAAGAAGCATGACTACCCTGCTCTGGCAGTGCTCATGGCCAACCT
ACACTTCTTGGTCCCACCCTTCATGAACCCCATTGTGTATTGCATCAAGTCTAGGCAGAT
CCGTCAGAGCCTCCTAAAGCACTTCCAGCAGAAGAGGATTGATGCTTTC
Conceptual translation MFSCNTSTSGQSTFLLTGFPGLEASHHWVSIPINLFCVVSILGNNIILFLIHTDPALHEP
MYIFLSMLAASDLGLCASTFPTMVRLFWLGARELPFDLCAAQMFFIHTFTYVESGVLLAM
AFDRFIAIRDPLHYAIIITCSVTAEVGTAILVRAVLLNLPGPILLQQLLFPKISALCHCY
CLHCDLVGLACSDTQINSLVGLVSILFSLCLDSFLIMLSYALILXVLGIASPGERLKAL
NTCVSHLCIVLIFYLPKRAVCLAPSKEAXHPALAVLMANLHFLVPPFMNPIVYCIKSRQ
IRQSLLKHFQQKRIDAF

Protein domains and features

Variations - SNPs

Chr Start End Type Variation AA Change SNP IDs
11 100 -100 SNP G/T 1000GP (YRI, YRI, YRI, YRI, YRI, YRI)
11 4,418,305 4,418,305 SNP T/C 1000GP (CEU, CHBJPT)
11 4,418,417 4,418,417 SNP A/C 1000GP (CEU, CHBJPT)
11 4,418,492 4,418,492 SNP G/A 1000GP (CEU, CHBJPT)
11 4,418,731 4,418,731 SNP A/G 1000GP (CEU)
11 4,418,739 4,418,739 SNP T/G 1000GP (CHBJPT)
11 4,439,535 4,439,535 SNP C/T rs1451659 (DbSNP)
11 4,439,647 4,439,647 SNP A/C rs1451660 (DbSNP)
11 4,439,652 4,439,652 SNP T/C rs2981551 (DbSNP)
11 4,439,653 4,439,653 SNP A/T rs2952736 (DbSNP)
11 4,439,660 4,439,660 SNP A/G rs74052109 (DbSNP)
11 4,439,722 4,439,722 SNP A/G rs1451661 (DbSNP)
11 4,439,961 4,439,961 SNP A/G rs72845389 (DbSNP)

Variations - CNVs

Chr Start End Type Sources
11 4,055,945 4,510,188 CopyNumber Variation_3834 (DGV)
11 4,333,543 4,474,341 CopyNumber Variation_2164 (DGV)
11 4,439,190 4,442,238 CopyNumber #145 (Waszak)

Haplotypes

Protein haplotypes were calculated using the 1000 genomes project as described in Olender T. et. al. BMC Genomics 2012.