Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

OR51T1 Olfactory Receptor

Gene Symbol OR51T11 (View this gene in GeneCards)
Family 51
Subfamily T
Pseudogene No
CORP pseudogene probability score 0.01 (functional)
Aliases OR11-26, HsOR11.3.30, ORL3418
External Ids HGNC: 15205   GeneBank: AB065795, BK004283, NM_001004759   ORDB: ORL3418   
Build #39 labels OR51T1
Chromosomal location 11:4,881,900-4,882,880 (+)
Cluster 11@5
Synteny CLIC#23
Remarks

Most Similar ORs in Humans (Paralogs)

Symbol Percent Length
OR51F1 53.21% 312
OR51F2 51.27% 314
OR51F5P 51.92% 312

Most Similar ORs in other species (Orthologs)

Specie Symbol Percent Length
Dog OR51T1 80% 327
Chimp CONTIG465.125-21560 99% 327
Mouse Or51t4 78% 327
Rat Or51f2b 54% 314
Cow OR51T1 78% 327

Expression evidences

Source Accession
mRNA BC172458
GNF Atlas2 gnf1h10686_at

Sequence information

Nucleotide sequence ATGGCAATATTCAATAACACCACTTCGTCTTCCTCAAACTTCCTCCTCACTGCATTCCCT
GGGCTGGAATGTGCTCATGTCTGGATCTCCATTCCAGTCTGCTGTCTCTACACCATTGCC
CTCTTGGGAAACAGTATGATCTTTCTTGTCATCATTACTAAGCGGAGACTCCACAAACCC
ATGTATTATTTCCTCTCCATGCTGGCAGCTGTTGATCTATGTCTGACCATTACGACCCTT
CCCACTGTGCTTGGTGTTCTCTGGTTTCATGCCCGGGAGATCAGCTTTAAAGCTTGCTTC
ATTCAAATGTTCTTTGTGCATGCTTTCTCCTTGCTGGAGTCCTCGGTGCTGGTAGCCATG
GCCTTTGACCGCTTCGTGGCTATCTGTAACCCACTGAACTATGCTACTATCCTCACAGAC
AGGATGGTCCTGGTGATAGGGCTGGTCATCTGCATTAGACCAGCAGTTTTCTTACTTCCC
CTTCTTGTAGCCATAAACACTGTGTCTTTTCATGGGGGTCACGAGCTTTCCCATCCATTT
TGCTACCACCCAGAAGTGATCAAATACACATATTCCAAACCTTGGATCAGCAGTTTTTGG
GGACTGTTTCTTCAGCTCTACCTGAATGGCACTGACGTATTGTTTATTCTTTTCTCCTAT
GTCCTGATCCTCCGTACTGTTCTGGGCATTGTGGCCCGAAAGAAGCAACAAAAAGCTCTC
AGCACTTGTGTCTGTCACATCTGTGCAGTCACTATTTTCTATGTGCCACTGATCAGCCTC
TCTTTGGCACACCGCCTCTTCCACTCCACCCCAAGGGTGCTCTGTAGCACTTTGGCCAAT
ATTTATCTGCTCTTACCACCTGTGCTGAACCCTATCATTTACAGCTTGAAGACCAAGACA
ATCCGCCAGGCTATGTTCCAGCTGCTCCAATCCAAGGGTTCATGGGGTTTTAATGTGAGG
GGTCTTAGGGGAAGATGGGAT
Conceptual translation MAIFNNTTSSSSNFLLTAFPGLECAHVWISIPVCCLYTIALLGNSMIFLVIITKRRLHKP
MYYFLSMLAAVDLCLTITTLPTVLGVLWFHAREISFKACFIQMFFVHAFSLLESSVLVAM
AFDRFVAICNPLNYATILTDRMVLVIGLVICIRPAVFLLPLLVAINTVSFHGGHELSHPF
CYHPEVIKYTYSKPWISSFWGLFLQLYLNGTDVLFILFSYVLILRTVLGIVARKKQQKAL
STCVCHICAVTIFYVPLISLSLAHRLFHSTPRVLCSTLANIYLLLPPVLNPIIYSLKTKT
IRQAMFQLLQSKGSWGFNVRGLRGRWD

Protein domains and features

Variations - SNPs

Chr Start End Type Variation AA Change SNP IDs
11 100 -100 SYN C/G V/V 1000GP (YRI, YRI, YRI)
11 4,882,852 4,882,852 NS A/G N/S 1000GP (CEU)
11 4,903,149 4,903,148 Ins(1) -/G rs34690738 (DbSNP)
11 4,903,210 4,903,210 SYN C/G V/V rs73405010 (DbSNP)
11 4,903,231 4,903,231 SYN C/T C/C rs61735140 (DbSNP)
11 4,903,319 4,903,318 Ins(1) -/G rs34407966 (DbSNP)
11 4,903,390 4,903,390 SYN C/G L/L rs61995697 (DbSNP)

Variations - CNVs

Chr Start End Type Sources
CopyNumber 90 (Hasin)

Haplotypes

Protein haplotypes were calculated using the 1000 genomes project as described in Olender T. et. al. BMC Genomics 2012.

R124H V213I % Freq CORP
1 R V 98.39 0.007
2 H V 1.15 0.111
3 R I 0.46 0.007

AceView Gene Models

The information is based on AceView gene models, constructed from cDNA sequences. The information might be incomplete.

Accession Type Chr Start End Strand
OR51T1.aApr07-unspliced main_exon 5UTR chr11 4,881,819 4,881,900 +
CDS chr11 4,881,900 4,882,880 +
3UTR chr11 4,882,880 4,882,883 +