Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

OR51V1 Olfactory Receptor

Gene Symbol OR51V11 (View this gene in GeneCards)
Family 51
Subfamily V
Pseudogene No
CORP pseudogene probability score 0.35 (functional)
Aliases
External Ids HGNC: 19597   GeneBank: BK004432, NM_001004760   
Build #39 labels
Chromosomal location 11:5,199,738-5,200,682 (-)
Cluster 11@5
Synteny CLIC#23
Remarks

Most Similar ORs in Humans (Paralogs)

Symbol Percent Length
OR51B5 53.42% 307
OR51F5P 55.52% 299
OR51L1 53.42% 307

Most Similar ORs in other species (Orthologs)

Specie Symbol Percent Length
Dog OR51V1 89% 296
Dog OR51V1CP 89% 272
Chimp CONTIG465.93-16648 98% 315
Mouse Or51v14 73% 309
Rat Or51v8b 77% 306
Cow OR51V1 88% 313
Cow OR51V1DP 88% 303

Expression evidences

Source Accession
mRNA AB528808

Sequence information

Nucleotide sequence ATGATTACTTCAGTAAGCCCTAGCACCAGCACGAATTCTTCCTTTCTTCTCACTGGATTT
TCTGGCATGGAGCAGCAATACCCCTGGCTTTCCATCCCCTTCTCCTCAATCTATGCCATG
GTGCTTTTGGGCAATTGCATGGTTCTCCATGTGATATGGACTGAGCCAAGCCTGCACCAG
CCTATGTTTTACTTCCTGTCCATGCTGGCCCTCACTGACCTGTGCATGGGGCTGTCCACT
GTGTACACAGTGCTGGGGATCCTGTGGGGGATCATTCGAGAGATCAGCTTGGATTCCTGC
ATTGCCCAGTCCTATTTCATCCATGGTCTGTCCTTCATGGAGTCCTCTGTCCTCCTCACT
ATGGCCTTTGACCGGTACATTGCAATTTGCAATCCACTACGTTATTCCTCCATCCTGACT
AATTCCAGAATTATCAAAATTGGGCTCACTATAATAGGTAGGAGTTTTTTCTTTATTACA
CCCCCCATCATCTGTCTGAAATTTTTTAATTACTGTCATTTCCACATCCTTTCTCACTCT
TTCTGCCTGCACCAGGATCTTCTCCGCTTAGCCTGTTCAGACATCCGATTCAATAGTTAC
TATGCCCTGATGCTGGTTATTTGCATACTGTTGTTGGATGCTATACTCATCCTTTTCTCC
TACATCCTGATTCTTAAGTCAGTCCTGGCAGTTGCCTCTCAGGAAGAGAGGCATAAATTA
TTTCAGACCTGCATCTCCCACATCTGTGCTGTCCTTGTGTTCTACATCCCTATCATTAGC
CTCACAATGGTGCACCGTTTTGGCAAGCACCTTTCCCCCGTGGCCCACGTTCTCATTGGC
AACATCTACATCCTTTTCCCACCTTTAATGAATCCCATCATCTACAGTGTCAAGACCCAA
CAGATTCATACCAGAATGCTTAGACTCTTTTCTCTGAAAAGATAT
Conceptual translation MITSVSPSTSTNSSFLLTGFSGMEQQYPWLSIPFSSIYAMVLLGNCMVLHVIWTEPSLHQ
PMFYFLSMLALTDLCMGLSTVYTVLGILWGIIREISLDSCIAQSYFIHGLSFMESSVLLT
MAFDRYIAICNPLRYSSILTNSRIIKIGLTIIGRSFFFITPPIICLKFFNYCHFHILSHS
FCLHQDLLRLACSDIRFNSYYALMLVICILLLDAILILFSYILILKSVLAVASQEERHKL
FQTCISHICAVLVFYIPIISLTMVHRFGKHLSPVAHVLIGNIYILFPPLMNPIIYSVKTQ
QIHTRMLRLFSLKRY

Protein domains and features

Variations - SNPs

Chr Start End Type Variation AA Change SNP IDs
11 100 -100 NS G/A L/F 1000GP (YRI, YRI, YRI, YRI, YRI, YRI)
11 100 -100 SYN A/G I/I 1000GP (YRI, YRI, YRI)
11 5,200,046 5,200,046 NS C/T D/N 1000GP (CEU)
11 5,200,415 5,200,415 NS C/A G/W 1000GP (CEU, CHBJPT)
11 5,200,584 5,200,584 SYN G/A P/P 1000GP (CEU)
11 5,200,595 5,200,595 NS G/A L/F 1000GP (CEU, CHBJPT)
11 5,215,518 5,215,518 large insertion 49939bp insertion rs63751627 (DbSNP)
11 5,221,076 5,221,076 SYN G/A I/I rs61735483 (DbSNP)
11 5,221,132 5,221,132 NS G/A L/F rs61736992 (DbSNP)
11 5,221,229 5,221,229 SYN G/A V/V rs61735021 (DbSNP)
11 5,221,233 5,221,233 NS A/G L/S rs7933549 (DbSNP)
11 5,221,424 5,221,424 SYN A/G I/I rs7933718 (DbSNP)
11 5,221,449 5,221,449 NS T/C N/S rs61732434 (DbSNP)
11 5,221,645 5,221,645 NS A/C/G W/G rs11512276 (DbSNP)
11 5,221,754 5,221,754 NS C/G W/C rs61738413 (DbSNP)
11 5,221,825 5,221,825 NS A/G F/L rs11036212 (DbSNP)

Haplotypes

Protein haplotypes were calculated using the 1000 genomes project as described in Olender T. et. al. BMC Genomics 2012.

I308S L267F S233L I133T P62L L36F S16R % Freq CORP
1 I L S I P F S 59.68 0.203
2 I L S I P L S 32.26 0.203
3 I L L I P L S 5.07 0.203
4 I F S I P F S 1.54 0.203
5 I L S I P L R 0.54 0.203
6 I L S I L L S 0.46 0.203
7 S L S I P F S 0.23 0.203
8 I L S T P F S 0.15 0.203
9 I L L I P F S 0.08 0.203

AceView Gene Models

The information is based on AceView gene models, constructed from cDNA sequences. The information might be incomplete.

Accession Type Chr Start End Strand
OR51V1.aApr07-unspliced main_exon 3UTR chr11 5,199,735 5,199,738 -
CDS chr11 5,199,738 5,200,682 -
5UTR chr11 5,200,682 5,200,700 -