Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

OR52A1 Olfactory Receptor

Gene Symbol OR52A11 (View this gene in GeneCards)
Family 52
Subfamily A
Pseudogene No
CORP pseudogene probability score 0.08 (functional)
Aliases OR11-319, HPFH1OR, HsOR11.3.51, ORL3331
External Ids HGNC: 8318   GeneBank: BK004431, NM_012375   ORDB: ORL3331   
Build #39 labels OR52A1
Chromosomal location 11:5,151,434-5,152,369 (-)
Cluster 11@5
Synteny CLIC#23
Remarks

Most Similar ORs in Humans (Paralogs)

Symbol Percent Length
OR52A5 74.84% 310

Most Similar ORs in other species (Orthologs)

Specie Symbol Percent Length
Dog OR52A1 87% 312
Chimp CONTIG*********** 98% 312
Mouse Or52a20 75% 309
Rat Or52a20 74% 313
Cow OR52A1 83% 312
Cow OR52A1E 83% 312
Cow OR52A1F 82% 312
Cow OR52A1C 83% 312
Cow OR52A1H 83% 312
Cow OR52A1G 84% 312
Cow OR52A1DP 82% 310

Expression evidences

Source Accession
mRNA AB463975
GNF Atlas2 221329_at

Sequence information

Nucleotide sequence ATGTCCATTTCCAACATCACAGTCTACATGCCCTCTGTGTTGACACTAGTAGGGATCCCA
GGCCTAGAATCTGTGCAGTGCTGGATTGGGATTCCATTCTGTGCCATTTATCTCATTGCT
ATGATTGGAAATTCCTTGCTTCTGAGCATCATCAAATCTGAGCGCAGTCTCCATGAGCCC
TTGTACATTTTCTTAGGCATGCTAGGAGCCACAGACATTGCACTTGCTAGCAGCATTATG
CCAAAGATGCTTGGAATATTCTGGTTTAATGTGCCTGAAATCTATTTTGATTCCTGCTTG
CTTCAAATGTGGTTCATCCACACATTGCAGGGTATAGAGTCAGGCATCCTTGTGGCCATG
GCCCTGGACCGTTATGTGGCCATCTGTTATCCACTAAGACATGCCAACATCTTCACCCAC
CAGCTTGTCATTCAGATAGGAACTATGGTCGTACTCAGGGCTGCTATTCTTGTAGCCCCA
TGCCTAGTACTGATAAAGTGCCGGTTTCAATTTTATCACACAACAGTCATCTCCCACTCC
TACTGTGAGCATATGGCCATTGTGAAACTAGCAGCAGCAAATGTTCAAGTCAACAAAATC
TATGGTTTGTTTGTGGCCTTCACTGTAGCAGGATTTGACCTCACATTCATCACATTGTCC
TACATCCAGATATTTATCACAGTTTTTCGTTTGCCCCAGAAGGAGGCTAGGTTTAAAGCA
TTCAATACCTGCATTGCTCACATCTGTGTCTTCCTCCAGTTCTACCTCCTTGCCTTCTTC
TCCTTCTTCACACATAGGTTTGGGTCTCACATCTCCCCTTATATCCATATTCTCTTTTCT
AGCATTTACTTGCTGGTCCCTCCATTTCTCAATCCACTTGTCTATGGTGCAAAGACCACA
CAGATTCGCATTCATGTGGTAAAAATGTTCTGTTCA
Conceptual translation MSISNITVYMPSVLTLVGIPGLESVQCWIGIPFCAIYLIAMIGNSLLLSIIKSERSLHEP
LYIFLGMLGATDIALASSIMPKMLGIFWFNVPEIYFDSCLLQMWFIHTLQGIESGILVAM
ALDRYVAICYPLRHANIFTHQLVIQIGTMVVLRAAILVAPCLVLIKCRFQFYHTTVISHS
YCEHMAIVKLAAANVQVNKIYGLFVAFTVAGFDLTFITLSYIQIFITVFRLPQKEARFKA
FNTCIAHICVFLQFYLLAFFSFFTHRFGSHISPYIHILFSSIYLLVPPFLNPLVYGAKTT
QIRIHVVKMFCS

Protein domains and features

Variations - SNPs

Chr Start End Type Variation AA Change SNP IDs
11 5,173,090 5,173,089 Ins(1) -/A rs36060295 (DbSNP)
11 5,172,786 5,172,786 NS A/G S/P rs10768611 (DbSNP)
11 5,151,919 5,151,919 NS C/A V/L 1000GP (CEU, CHBJPT)
11 5,151,556 5,151,556 NS A/G S/P 1000GP (CEU, CHBJPT)
11 100 -100 SYN G/A R/R 1000GP (YRI)
11 100 -100 NS A/G S/P 1000GP (YRI)

Haplotypes

Protein haplotypes were calculated using the 1000 genomes project as described in Olender T. et. al. BMC Genomics 2012.

V151L R124H W88* G21D % Freq CORP
1 V R W G 94.39 0.095
2 L R W G 5.38 0.095
3 V R W D 0.08 0.095
4 V H W G 0.08 0.652
5 V R * G 0.08 1.200

AceView Gene Models

The information is based on AceView gene models, constructed from cDNA sequences. The information might be incomplete.

Accession Type Chr Start End Strand
OR52A1.aApr07-unspliced main_exon 3UTR chr11 5,151,431 5,151,434 -
CDS chr11 5,151,434 5,152,369 -