Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

OR52B1P Olfactory Receptor

Gene Symbol OR52B1P1 (View this gene in GeneCards)
Family 52
Subfamily B
Pseudogene Yes
CORP pseudogene probability score
Aliases OR11-69, PJCG4, HsOR11.3.100P, ORL3558
External Ids HGNC: 15206   GeneBank: AB065764, AF359415, BK004596, NG_004225   ORDB: ORL3558   
Build #39 labels OR52B1P
Chromosomal location 11:6,151,595-6,152,549 (-)
Cluster 11@6
Synteny CLIC#23
Remarks

Most Similar ORs in Humans (Paralogs)

Symbol Percent Length
OR52B2 70.03% 307

Most Similar ORs in other species (Orthologs)

Specie Symbol Percent Length
Dog OR52B2 70% 307
Chimp CONTIG784.106-5416 96% 313
Mouse Or52b1 85% 315
Rat Or52b1 84% 315
Cow OR52B2 70% 307

Expression evidences

Source Accession
ESTs CD642260
mRNA AB529252
GNF Atlas2 gnf1h11080_at

Sequence information

Nucleotide sequence ATGTTTGGTGCTAATCTCACCACCTTCCATCCCACTCTATTCATTCTCCTTGGCATCCCA
GGACTGGAGCAATACCACATCTGGCTTTCCATTCCTTTCTACCTTATGTACATCACTGCA
GTCTTGGGAAATGGAGCCCTCATCCTAGTTGTCCTCAGTGAACACACCCTCCATGTCTTC
CTATCCATGCTGGCTGGCACTGATATCCTGCTATCCACCACCACTGTGCCTAAGGCCTTG
GCGATCTTCTGGGTCCACGCTGGGGAGATAGCCTTTGATGCCTGCATTACTCAGATGTTT
TTCATTCATGTTGCCTTTGTGGCTGAGTCAGGAATCCTGCTGGCCATGGCATTTGACAGT
TATGTAGCCATTTGTACTCCCTTGAGATACACTACCATCTTAACTTCTATGGTAAATGGA
AAAATGACCCTGACAATCTGGGGACAAAGCATTGGGACAATTTTTCCTGTCATATTCCTG
CTGAAGAGGCTGCCATACTGTCAGACCAATATCATCCCCCACTCATACTGTGAGCACATT
GGGGTGGCCCAATTGGCCTGTGCTGACATAACTGTCAATATCTGGTATGGCTTTTCAGTG
CCAATGGCATCGGTTTTGGTAGATGTTGCATTCATTGGTTTTTCCTACACTTTGATCCTC
CAGGCTGTGTTTAGACTTCCTTCCCAGGAGTCCCAGCACAAAGCTCTTAACACCTGTGGT
TCTACATTGGAGTTGTTCTCCTCTTCTTCATCCCATCATTTTTTACTTTCCTGACCCACC
GCTTTGGCAAGAATATCCCCCATCATGTCCACATACTTCTGGCAAATCTCTACTTGCTTG
TTCCCCCATGCTTAACCCCATTATCTACGGAGAGAAGACCAAGCAAATCAGGGACAGTAT
GGCTCATATGTTATCTGTGGTGGGGAAGTCTTGAGACATCATGGTCTCTTCACAG
Conceptual translation MFGANLTTFHPTLFILLGIPGLEQYHIWLSIPFYLMYITAVLGNGALILVVLSEHTLHVF
LSMLAGTDILLSTTTVPKALAIFWVHAGEIAFDACITQMFFIHVAFVAESGILLAMAFDS
YVAICTPLRYTTILTSMVNGKMTLTIWGQSIGTIFPVIFLLKRLPYCQTNIIPHSYCEHI
GVAQLACADITVNIWYGFSVPMASVLVDVAFIGFSYTLILQAVFRLPSQESQHKALNTCG
STL/VVLLFFIPSFFTFLTHRFGKNIPHHVHILLANLYLLV/PMLNPIIYGEKTKQIR
DSMAHMLSVVGKSXIMVSSQ

Protein domains and features

Variations - SNPs

Chr Start End Type Variation AA Change SNP IDs
11 100 -100 SNP A/G 1000GP (YRI, YRI, YRI, YRI)
11 6,151,603 6,151,603 SNP A/G 1000GP (CEU, CHBJPT)
11 6,151,770 6,151,770 SNP G/T 1000GP (CEU)
11 6,152,112 6,152,112 SNP G/C 1000GP (CHBJPT)
11 6,152,116 6,152,116 SNP G/T 1000GP (CEU, CHBJPT)
11 6,152,134 6,152,134 SNP T/A 1000GP (CEU, CHBJPT)
11 6,172,833 6,172,833 SNP G/A rs325694 (DbSNP)
11 6,173,000 6,173,000 SNP G/T rs17237074 (DbSNP)
11 6,173,346 6,173,346 SNP G/T rs11826453 (DbSNP)
11 6,173,364 6,173,364 SNP A/T rs325695 (DbSNP)

Variations - CNVs

Chr Start End Type Sources
11 5,505,764 6,194,475 CopyNumber Variation_34458 (DGV)
11 6,170,825 6,173,879 Deletion #201 (Waszak)

Haplotypes

Protein haplotypes were calculated using the 1000 genomes project as described in Olender T. et. al. BMC Genomics 2012.

AceView Gene Models

The information is based on AceView gene models, constructed from cDNA sequences. The information might be incomplete.

Accession Type Chr Start End Strand
OR52B1P.aApr07-unspliced main_exon CDS_partial chr11 6,151,690 6,152,183 -