Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

OR52B2 Olfactory Receptor

Gene Symbol OR52B21 (View this gene in GeneCards)
Family 52
Subfamily B
Pseudogene No
CORP pseudogene probability score 0.04 (functional)
Aliases OR11-70, HsOR11.3.101, ORL3403
External Ids HGNC: 15207   GeneBank: AB065763, AB065939, AF399505, BK004324, NM_001004052   ORDB: ORL3403   
Build #39 labels OR52B2
Chromosomal location 11:6,169,358-6,170,326 (-)
Cluster 11@6
Synteny CLIC#23
Remarks

Most Similar ORs in Humans (Paralogs)

Symbol Percent Length
OR52B1P 70.03% 307

Most Similar ORs in other species (Orthologs)

Specie Symbol Percent Length
Dog OR52H1C 67% 301
Mouse Or52b2 88% 322
Rat Or52b2 89% 322
Cow OR52H2 66% 305
Orang OR52B1P 72% 303
Horse OR52H1 65% 301
Chimp OR52B2P 96% 324

Expression evidences

Source Accession
mRNA BC136733
GNF Atlas2 gnf1h05408_s_at

Sequence information

Nucleotide sequence ATGAGTCACACCAATGTTACCATCTTCCATCCTGCAGTTTTTGTCCTTCCTGGCATCCCT
GGGTTGGAGGCTTATCACATTTGGCTGTCAATACCTCTTTGCCTCATTTACATCACTGCA
GTCCTGGGAAACAGCATCCTGATAGTGGTTATTGTCATGGAACGTAACCTTCATGTGCCC
ATGTATTTCTTCCTCTCAATGCTGGCCGTCATGGACATCCTGCTGTCTACCACCACTGTG
CCCAAGGCCCTAGCCATCTTTTGGCTTCAAGCACATAACATTGCTTTTGATGCCTGTGTC
ACCCAAGGCTTCTTTGTCCATATGATGTTTGTGGGGGAGTCAGCTATCCTGTTAGCCATG
GCCTTTGATCGCTTTGTGGCCATTTGTGCCCCACTGAGATATACAACAGTGCTAACATGG
CCTGTTGTGGGGAGGATTGCTCTGGCCGTCATCACCCGAAGCTTCTGCATCATCTTCCCA
GTCATATTCTTGCTGAAGCGGCTGCCCTTCTGCCTAACCAACATTGTTCCTCACTCCTAC
TGTGAGCATATTGGAGTGGCTCGTTTAGCCTGTGCTGACATCACTGTTAACATTTGGTAT
GGCTTCTCAGTGCCCATTGTCATGGTCATCTTGGATGTTATCCTCATCGCTGTGTCTTAC
TCACTGATCCTCCGAGCAGTGTTTCGTTTGCCCTCCCAGGATGCTCGGCACAAGGCCCTC
AGCACTTGTGGCTCCCACCTCTGTGTCATCCTTATGTTTTATGTTCCATCCTTCTTTACC
TTATTGACCCATCATTTTGGGCGTAATATTCCTCAACATGTCCATATCTTGCTGGCCAAT
CTTTATGTGGCAGTGCCACCAATGCTGAACCCCATTGTCTATGGTGTGAAGACTAAGCAG
ATACGTGAGGGTGTAGCCCACCGGTTCTTTGACATCAAGACTTGGTGCTGTACCTCCCCT
CTGGGCTCA
Conceptual translation MSHTNVTIFHPAVFVLPGIPGLEAYHIWLSIPLCLIYITAVLGNSILIVVIVMERNLHVP
MYFFLSMLAVMDILLSTTTVPKALAIFWLQAHNIAFDACVTQGFFVHMMFVGESAILLAM
AFDRFVAICAPLRYTTVLTWPVVGRIALAVITRSFCIIFPVIFLLKRLPFCLTNIVPHSY
CEHIGVARLACADITVNIWYGFSVPIVMVILDVILIAVSYSLILRAVFRLPSQDARHKAL
STCGSHLCVILMFYVPSFFTLLTHHFGRNIPQHVHILLANLYVAVPPMLNPIVYGVKTKQ
IREGVAHRFFDIKTWCCTSPLGS

Protein domains and features

Variations - SNPs

Chr Start End Type Variation AA Change SNP IDs
11 100 -100 NS C/T R/H 1000GP (YRI, YRI, YRI, YRI)
11 100 -100 SYN G/A F/F 1000GP (YRI)
11 6,169,620 6,169,620 NS C/T R/Q 1000GP (CEU)
11 6,169,879 6,169,879 NS C/T V/I 1000GP (CHBJPT)
11 6,190,974 6,190,974 NS C/T A/T rs35364339 (DbSNP)
11 6,191,003 6,191,003 NS C/G G/A rs7483525 (DbSNP)
11 6,191,008 6,191,008 SYN A/G H/H rs7480755 (DbSNP)
11 6,191,109 6,191,109 NS C/T V/I rs11040779 (DbSNP)
11 6,191,243 6,191,243 NS A/T F/Y rs16909422 (DbSNP)
11 6,191,478 6,191,478 NS T/G I/L rs61738682 (DbSNP)

Variations - CNVs

Chr Start End Type Sources
11 5,505,764 6,194,475 CopyNumber Variation_34458 (DGV)
11 6,188,588 6,191,656 Deletion, CopyNumber #295 (Waszak)
11 6,189,710 6,193,096 CopyNumber Variation_65854 (DGV)
11 6,189,746 6,193,323 CopyNumber Variation_85637 (DGV)

Haplotypes

Protein haplotypes were calculated using the 1000 genomes project as described in Olender T. et. al. BMC Genomics 2012.

R268H M252L R236Q V150I F105Y I46T I27L % Freq CORP
1 R M R V F I I 91.63 0.038
2 R M R V Y I I 3.07 0.038
3 R M Q V F I I 2.30 0.038
4 R M R V Y I L 2.00 0.038
5 R L R V F T I 0.46 0.038
6 H M R V Y I I 0.31 0.038
7 R M R I F I I 0.15 0.038
8 H M R V F I I 0.08 0.038

AceView Gene Models

The information is based on AceView gene models, constructed from cDNA sequences. The information might be incomplete.

Accession Type Chr Start End Strand
OR52B2.aApr07-unspliced main_exon 3UTR chr11 6,169,355 6,169,358 -
CDS chr11 6,169,358 6,170,326 -