Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

OR52B3P Olfactory Receptor

Gene Symbol OR52B3P1 (View this gene in GeneCards)
Family 52
Subfamily B
Pseudogene Yes
CORP pseudogene probability score
Aliases OR11-4, PJCG7, HsOR11.3.3P, ORL3563
External Ids HGNC: 15208   GeneBank: AB065523, AF359417, BK004565, NG_004311   ORDB: ORL3563   
Build #39 labels OR52B3P
Chromosomal location 11:4,378,282-4,379,224 (+)
Cluster 11@5
Synteny CLIC#23
Remarks

Most Similar ORs in Humans (Paralogs)

Symbol Percent Length
OR52B4 63.38% 314

Most Similar ORs in other species (Orthologs)

Specie Symbol Percent Length
Dog OR52B3 82% 311
Chimp CONTIG465.170-2645 97% 314
Mouse Or52b3 83% 314
Rat Or52b3-ps 78% 314
Cow OR52B3 83% 314

Expression evidences

Source Accession
mRNA AF359417
GNF Atlas2 gnf1h10983_at

Sequence information

Nucleotide sequence ATGACAACCCACAACTCCACTGGTAGCAGCCACTCACTCTTCATTCTGCTGAGCATTCCT
GGCTTAGAAGACCAGCACACATGGATGTCTCTCCCCTTCTTTATTTCCTACCTTGTTGCT
TTCCTTGGGAACAGCCTCATCATCTTCATCATCATCACTGAATGCAGCCTCCACGAACCC
ATGTACCTTTTCCTCTGCATGCTGGCTGTGGCTGACCTTATCCTGTCTACTACCACTGTG
CCCAAGGCCCTAGCCATATTTTGGTTCTATGCTGGAGCAATATCCCTTGGTGGCTGTGTT
ACCCAAATCTTCTTTATCCATGCTACCTTCATCGAGGAATCAGGAATTCTGTTGGCGATG
GCACTTGACCGCTATGTGGCCATCTGTGATCCACTGCACTATACCACAGTGCTCAGTCGT
GCAAAAATCACAAAGATTGGCTTGGCTGTGGTCCTGAGAAGCTTCTGTGTGATCATGCCA
GATGTGTTTCTGGTAAAGCGGCTGCCTTTCTGCCATAGCAATCTGCTGCCACATACCTAC
TGTGAGCACATGGCTGTTGCCAAGTTTGCTTGTGCTGATATTCATGTCAATGTTTGGTAT
GGCTTGTCTGTCCTTCTCTATACTGTAGTGCTAGATGCCTTGCTTATCTTAGTGTCCTAT
AGCTTCATCCTGTATACAGGCTTCCACCTCCCCTCCCCAAGGAGCTCGGCAAAAGGCTCT
GGGCACATGTGGCTCCCACCTCAGAGTCATTTCCATGTTCTACTTGCCTGGTATTTTTAC
CATAATTACCCAGCGGTTTGGGCACCATGTTCCTCTCCATACACACATTCTGCTGGCTAA
TGTCTGCGTGTTGGCTCCTCCCATGCTGAACCCCATCATTTATGGGATCAACACCAGGCA
GATTCAAGAGTGTGTGCTCAGTCTTTTGTCCTCACAGAGGAAA
Conceptual translation MTTHNSTGSSHSLFILLSIPGLEDQHTWMSLPFFISYLVAFLGNSLIIFIIITECSLHEP
MYLFLCMLAVADLILSTTTVPKALAIFWFYAGAISLGGCVTQIFFIHATFIEESGILLAM
ALDRYVAICDPLHYTTVLSRAKITKIGLAVVLRSFCVIMPDVFLVKRLPFCHSNLLPHTY
CEHMAVAKFACADIHVNVWYGLSVLLYTVVLDALLILVSYSFILYTGFHLPSPRS\QKA
LGTCGSHLRVISMFYLPGIFTIITQRFGHHVPLHTHILLANVCVLAPPMLNPIIYGINTR
QIQECVLSLLSSQRK

Protein domains and features

Variations - SNPs

Chr Start End Type Variation AA Change SNP IDs
11 100 -100 SNP T/C 1000GP (YRI, YRI, YRI, YRI)
11 4,378,303 4,378,303 SNP G/A 1000GP (CEU)
11 4,378,333 4,378,333 SNP A/G 1000GP (CEU)
11 4,378,514 4,378,514 SNP C/T 1000GP (CEU)
11 4,378,604 4,378,604 SNP C/T 1000GP (CHBJPT)
11 4,378,706 4,378,706 SNP A/C 1000GP (CEU, CHBJPT)
11 4,378,887 4,378,887 SNP G/T 1000GP (CHBJPT)
11 4,379,038 4,379,038 SNP G/A 1000GP (CHBJPT)
11 4,399,727 4,399,727 SNP C/G rs11032023 (DbSNP)
11 4,399,936 4,399,936 SNP A/C rs7124081 (DbSNP)
11 4,400,131 4,400,131 SNP A/C rs11821519 (DbSNP)
11 4,400,271 4,400,271 SNP T/C rs433940 (DbSNP)
11 4,400,341 4,400,341 SNP T/C rs426034 (DbSNP)
11 4,400,355 4,400,355 SNP T/C rs431345 (DbSNP)

Variations - CNVs

Chr Start End Type Sources
11 4,055,945 4,510,188 CopyNumber Variation_3834 (DGV)
11 4,333,543 4,474,341 CopyNumber Variation_2164 (DGV)
11 4,400,251 4,400,481 Del(-23) #15(modil)

Haplotypes

Protein haplotypes were calculated using the 1000 genomes project as described in Olender T. et. al. BMC Genomics 2012.

AceView Gene Models

The information is based on AceView gene models, constructed from cDNA sequences. The information might be incomplete.

Accession Type Chr Start End Strand
OR52B3P.aApr07-unspliced main_exon CDS_partial chr11 4,378,639 4,379,163 +