Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

OR52B5P Olfactory Receptor

Gene Symbol OR52B5P1 (View this gene in GeneCards)
Family 52
Subfamily B
Pseudogene Yes
CORP pseudogene probability score
Aliases HsOR11.3.72P, ORL3615
External Ids HGNC: 15210   GeneBank: AF209507, NG_004224   ORDB: ORL3615   
Build #39 labels OR52B5P
Chromosomal location 11:5,560,967-5,561,911 (+)
Cluster 11@5
Synteny CLIC#23
Remarks

Most Similar ORs in Humans (Paralogs)

Symbol Percent Length
OR52B2 58.17% 306
OR52B3P 56.05% 314
OR52B4 56.72% 305

Most Similar ORs in other species (Orthologs)

Specie Symbol Percent Length
Dog OR52B6 61% 310
Chimp CONTIG*********** 96% 308
Mouse Or52h2 60% 308
Rat Or52b1 59% 310
Cow OR52B3 60% 314

Expression evidences

Source Accession
mRNA AF209507

Sequence information

Nucleotide sequence ATGTCAGCTCCCAACCACTCCACTGCCAATCATGATATGTTTGTCCTCATTGGCGTTCCT
GGCCTGAAGGAGCTGCACGTGTGGATCTCCATCCCCTTCTGTCTGATGTACCTGGTGGCT
GTGTCAGGAAATGGTCTCCTTGTCTGTGTGGTGGCAGTGGAGCACAGTCTTCATGAACCT
ATGTACCTTTTCCTCTCCATGCTGGCATTTTGGGATCTGATTCTATCCACATCTGCAGTA
CCCAAAGCCTTGAGCATTTTCTGGTTTGATGATGTGGACATCTCCTTTGGTGGCTGTGTC
ACTCAGCTCTTTTTTATGCATTTTGCCTTTGTAGCGGAGTCAGGCATTCTCTTGACCATG
GCTTTCGACCGCTATGTGGCCATCTGCTACCCATTGAGGTATAGCACCATCCTTAGCCAC
AGTGTTATTGGCAAAATTGGGGGTGTCGTGGTGTTCAGGAGTTTTGCAACTGTCTTCTCC
ATCGTCTTCCTTGTGAAGCGTCTGCCCTTCTGCCGGACAAACATCATTGCCCACACCTTC
TGTGAACACATGGGGCTGGCAAAGCTAGGTTGTTCTGAAATCACCATCAATATTTGGTAT
GGAATCTCTGTACCACTACTCAGTGTTACGTTAGATATGGTGACAATAGTCATCTCCTAG
GGGCTCATAGTTCAAGCAGTCTTCAGGCTGCCCTCCCTTGGTGCTTGGATGAAAGCACTC
AGCACCTGTGGTTCCCATGGCAGTGTCATCCTCATGTTCTGCCTTCCAGGAATTTTCACT
GTCATTGTTCAGCGCTTTGCCTGAAAATTTCCCAAGTATGTCCACATCCTGCTGGCCAAT
CTCTATGTTCTTGTTCCCCCCATGATGAACCCAATTATCTATGGAGTAAAGACTAAACAG
ATTCAGAAAGGGGTTGCCCTTGTGTTTTCTCCAAAAGGAAAATGT
Conceptual translation MSAPNHSTANHDMFVLIGVPGLKELHVWISIPFCLMYLVAVSGNGLLVCVVAVEHSLHEP
MYLFLSMLAFWDLILSTSAVPKALSIFWFDDVDISFGGCVTQLFFMHFAFVAESGILLTM
AFDRYVAICYPLRYSTILSHSVIGKIGGVVVFRSFATVFSIVFLVKRLPFCRTNIIAHTF
CEHMGLAKLGCSEITINIWYGISVPLLSVTLDMVTIVISXLIVQAVFRLPSLGAWMKAL
STCGSHGSVILMFCLPGIFTVIVQRFAXFPKYVHILLANLYVLVPPMMNPIIYGVKTKQ
IQKGVALVFSPKGKC

Protein domains and features

Variations - SNPs

Chr Start End Type Variation AA Change SNP IDs
11 100 -100 SNP A/G 1000GP (YRI, YRI, YRI, YRI, YRI, YRI, YRI, YRI)
11 5,561,130 5,561,130 SNP A/G 1000GP (CEU)
11 5,561,200 5,561,200 SNP T/C 1000GP (CEU)
11 5,561,332 5,561,332 SNP C/T 1000GP (CEU)
11 5,561,355 5,561,355 SNP A/C 1000GP (CEU)
11 5,561,369 5,561,369 SNP A/G 1000GP (CEU)
11 5,561,828 5,561,828 SNP A/T 1000GP (CEU, CHBJPT)
11 5,582,360 5,582,360 SNP A/G rs11607280 (DbSNP)
11 5,582,430 5,582,430 SNP C/T rs11607755 (DbSNP)
11 5,582,498 5,582,498 SNP C/T rs56774399 (DbSNP)
11 5,582,562 5,582,562 SNP C/T rs35563908 (DbSNP)
11 5,582,585 5,582,585 SNP A/C rs11607312 (DbSNP)
11 5,582,599 5,582,599 SNP A/G rs11607314 (DbSNP)
11 5,582,607 5,582,607 SNP C/A rs2008544 (DbSNP)
11 5,583,058 5,583,058 SNP A/T rs11038105 (DbSNP)

Variations - CNVs

Chr Start End Type Sources
11 5,505,764 6,194,475 CopyNumber Variation_34458 (DGV)

Haplotypes

Protein haplotypes were calculated using the 1000 genomes project as described in Olender T. et. al. BMC Genomics 2012.

AceView Gene Models

The information is based on AceView gene models, constructed from cDNA sequences. The information might be incomplete.

Accession Type Chr Start End Strand
OR52B5P.aApr07-unspliced main_exon CDS_partial chr11 5,561,324 5,561,844 +