Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

OR52B6 Olfactory Receptor

Gene Symbol OR52B61 (View this gene in GeneCards)
Family 52
Subfamily B
Pseudogene No
CORP pseudogene probability score 0.09 (functional)
Aliases HsOR11.3.74, ORL3424
External Ids HGNC: 15211   ORDB: ORL3424   
Build #39 labels OR52B6
Chromosomal location 11:5,580,940-5,581,881 (+)
Cluster 11@5
Synteny CLIC#23
Remarks

Most Similar ORs in Humans (Paralogs)

Symbol Percent Length
OR52B2 59.73% 298
OR52B5P 56.67% 300
OR52Z1P 60.27% 297

Most Similar ORs in other species (Orthologs)

Specie Symbol Percent Length
Dog OR52B6 83% 315
Chimp CONTIG465.57-42854 96% 314
Mouse Or52b6-ps 80% 315
Rat Or52b6-ps 80% 315
Cow OR52B6 83% 315
Cow OR52B28P 85% 212

Sequence information

Nucleotide sequence ATGAACAACTCTGACACTCGCATAGCAGGCTGCTTCCTCACTGGCATCCCTGGGCTGGAG
CAACTACATATCTGGCTGTCCATCCCCTTCTGCATCATGTACATCACTGCCCTGGAAGGC
AATGGCATCCTAATTTGTGTCATCCTCTCCCAGGCAATCCTGCATGAGCCCATGTACATA
TTCTTATCTATGCTGGCCAGTGCTGATGTCTTGCTCTCTACCACCACCATGCCTAAGGCC
CTGGCCAATTTGTGGCTAGGTTATAGCCTCATTTCCTTTGATGGCTGCCTCACTCAGATG
TTCTTCATTCACTTCCTCTTCATTCACTCTGCTGTCCTGCTGGCCATGGCCTTTGACCGC
TATGTGGCCATCTGCTCCCCCCTGCGATATGTCACAATCCTCACAAGCAAGGTCATTGGG
AAGATCGTCACTGCCGCCCTGAGCCACAGCTTCATCATTATGTTTCCATCCATCTTTCTC
CTTGAGCACCTGCACTATTGCCAGATCAATATCATTGCACACACATTTTGTGAGCACATG
GGCATTGCCCATCTGTCCTGTTCTGATATCTCCATCAATGTCTGGTATGGGTTGGCAGCT
GCTCTTCTCTCCACAGGCCTAGACATCATGCTTATTACTGTTTCCTACATCCACATCCTC
CAAGCAGTCTTCCGCCTCCTTTCTCAAGATGCCCGCTCCAAGGCCCTGAGTACCTGTGGA
TCCCATATCTGTGTCATCCTACTCTTCTATGTCCCTGCGCTTTTTTCTGTCTTTGCCTAC
AGGTTTGGTGGGAGAAGCGTCCCATGCTATGTCCATATTCTCCTGGCCAGCCTCTACGTT
GTCATTCCTCCTATGCTCAATCCCGTTATTTATGGAGTGAGGACTAAGCCAATACTGGAA
GGGGCTAAGCAGATGTTTTCAAATCTTGCCAAAGGATCTAAA
Conceptual translation MNNSDTRIAGCFLTGIPGLEQLHIWLSIPFCIMYITALEGNGILICVILSQAILHEPMYI
FLSMLASADVLLSTTTMPKALANLWLGYSLISFDGCLTQMFFIHFLFIHSAVLLAMAFDR
YVAICSPLRYVTILTSKVIGKIVTAALSHSFIIMFPSIFLLEHLHYCQINIIAHTFCEHM
GIAHLSCSDISINVWYGLAAALLSTGLDIMLITVSYIHILQAVFRLLSQDARSKALSTCG
SHICVILLFYVPALFSVFAYRFGGRSVPCYVHILLASLYVVIPPMLNPVIYGVRTKPILE
GAKQMFSNLAKGSK

Protein domains and features

Variations - SNPs

Chr Start End Type Variation AA Change SNP IDs
11 5,602,587 5,602,586 Ins(1) -/G rs34340459 (DbSNP)
11 5,602,929 5,602,929 NS A/C I/L rs74053516 (DbSNP)
11 5,602,773 5,602,773 NS A/C I/L rs61892481 (DbSNP)
11 5,602,615 5,602,615 NS A/G H/R rs2341434 (DbSNP)
11 5,602,605 5,602,605 NS A/G T/A rs2341433 (DbSNP)
11 5,602,275 5,602,275 NS A/G T/A rs1077126 (DbSNP)
11 5,602,968 5,602,968 NS A/G I/V rs10769086 (DbSNP)
11 5,602,438 5,602,438 NS A/T H/L rs2341432 (DbSNP)
11 5,602,790 5,602,790 SYN A/G L/L rs2163946 (DbSNP)
11 5,602,928 5,602,928 SYN C/G A/A rs10838375 (DbSNP)
11 5,602,679 5,602,679 SYN C/T N/N rs892336 (DbSNP)
11 5,581,698 5,581,698 SYN G/C A/A 1000GP (CEU, CHBJPT)
11 5,581,045 5,581,045 NS A/G T/A 1000GP (CEU, CHBJPT)
11 5,581,208 5,581,208 NS T/A L/H 1000GP (CEU, CHBJPT)
11 5,581,699 5,581,699 NS C/A L/I 1000GP (CEU)
11 5,581,738 5,581,738 NS G/A V/I 1000GP (CEU, CHBJPT)
11 5,581,560 5,581,560 SYN A/G L/L 1000GP (CEU, CHBJPT)
11 5,581,449 5,581,449 SYN T/C N/N 1000GP (CEU, CHBJPT)
11 5,581,385 5,581,385 NS A/G H/R 1000GP (CEU, CHBJPT)
11 5,581,375 5,581,375 NS G/A A/T 1000GP (CEU, CHBJPT)
11 100 -100 NS T/C L/P 1000GP (YRI, YRI, YRI, YRI, YRI, YRI, YRI, YRI)
11 100 -100 SYN T/C N/N 1000GP (YRI, YRI, YRI, YRI)

Variations - CNVs

Chr Start End Type Sources
11 5,505,764 6,194,475 CopyNumber Variation_34458 (DGV)

Haplotypes

Protein haplotypes were calculated using the 1000 genomes project as described in Olender T. et. al. BMC Genomics 2012.

L47P T57A R141C A144V L275I V288I % Freq CORP
1 L A R A L I 54.07 0.904
2 L T R A L I 30.03 0.904
3 L T R A L V 11.83 0.904
4 L T R A I I 2.00 0.904
5 L A C A L I 0.77 0.904
6 L A R A I I 0.77 0.904
7 P T R A L I 0.23 0.904
8 L T R V L I 0.23 0.904
9 P T R V L I 0.08 0.904

AceView Gene Models

The information is based on AceView gene models, constructed from cDNA sequences. The information might be incomplete.

Accession Type Chr Start End Strand
OR52B6.aApr07-unspliced main_exon 5UTR chr11 5,580,877 5,580,940 +
CDS chr11 5,580,940 5,581,881 +
3UTR chr11 5,581,881 5,581,884 +