Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

OR52D1 Olfactory Receptor

Gene Symbol OR52D11 (View this gene in GeneCards)
Family 52
Subfamily D
Pseudogene No
CORP pseudogene probability score
Aliases OR11-43, HsOR11.3.68
External Ids HGNC: 15212   GeneBank: BK004276, NM_001005163   
Build #39 labels OR52D1
Chromosomal location 11:5,488,707-5,489,660 (+)
Cluster 11@5
Synteny CLIC#23
Remarks Segregating Pseudo Gene, a nonsynonymous SNP in a highly conserved amino-acid (rs7950082)

Most Similar ORs in Humans (Paralogs)

Symbol Percent Length
OR52B2 58.88% 304
OR52E8 59.81% 311
OR52S1P 57.65% 307

Most Similar ORs in other species (Orthologs)

Specie Symbol Percent Length
Dog OR52D1 89% 315
Dog OR52D1C 87% 318
Chimp CONTIG465.62-19284 99% 318
Mouse Or52d1 89% 308
Rat Or52d1 87% 314
Cow OR52D1 87% 318
Cow OR52D1D 86% 318
Cow OR52D1E 85% 318

Expression evidences

Source Accession
mRNA BC136930
GNF Atlas2 gnf1h05402_at

Sequence information

Nucleotide sequence ATGTCAGATTCCAACCTCAGTGATAACCATCTTCCAGACACCTTCTTCTTAACAGGGATC
CCAGGGCTGGAGGCTGCCCACTTCTGGATTGCCATCCCTTTCTGTGCCATGTATCTTGTA
GCACTGGTTGGAAATGCTGCCCTCATCCTGGTCATTGCCATGGACAATGCTCTTCATGCA
CCTATGTACCTCTTCCTCTGCCTTCTCTCACTCACAGACCTGGCTCTCAGTTCTACCACT
GTGCCCAAGATGCTGGCCATTTTGTGGCTCCATGCTGGTGAGATTTCCTTTGGTGGATGC
CTGGCCCAGATGTTTTGTGTCCATTCTATCTATGCTCTGGAGTCCTCAATTCTACTTGCC
ATGGCCTTTGATAGGTATGTGGCTATCTGTAACCCATTAAGGTACACAACCATTCTCAAC
CATGCTGTCATAGGCAGAATTGGCTTTGTTGGGCTATTCCGTAGTGTGGCTATTGTCTCC
CCCTTCATCTTCTTGCTGAGGCGACTCCCCTACTGTGGTCACCGTGTCATGACACACACA
TACTGTGAGCATATGGGCATTGCCCGACTGGCCTGTGCCAACATCACTGTCAATATTGTC
TATGGGCTAACTGTGGCTCTGCTGGCCATGGGACTGGATTCCATTCTCATTGCCATTTCC
TATGGCTTTATCCTCCATGCAGTCTTTCATCTTCCATCTCATGATGCCCAGCACAAAGCT
CTGAGTACCTGTGGCTCCCACATTGGCATCATCCTGGTTTTCTACATCCCTGCCTTCTTC
TCCTTCCTCACCCACCGCTTTGGTCACCACGAAGTCCCCAAGCATGTGCACATCTTTCTG
GCTAATCTCTATGTGCTGGTGCCTCCTGTACTCAATCCTATTCTCTATGGAGCTAGAACC
AAGGAGATTCGGAGTCGACTTCTAAAACTGCTTCACCTGGGGAAGACTTCAATA
Conceptual translation MSDSNLSDNHLPDTFFLTGIPGLEAAHFWIAIPFCAMYLVALVGNAALILVIAMDNALHA
PMYLFLCLLSLTDLALSSTTVPKMLAILWLHAGEISFGGCLAQMFCVHSIYALESSILLA
MAFDRYVAICNPLRYTTILNHAVIGRIGFVGLFRSVAIVSPFIFLLRRLPYCGHRVMTHT
YCEHMGIARLACANITVNIVYGLTVALLAMGLDSILIAISYGFILHAVFHLPSHDAQHKA
LSTCGSHIGIILVFYIPAFFSFLTHRFGHHEVPKHVHIFLANLYVLVPPVLNPILYGART
KEIRSRLLKLLHLGKTSI

Protein domains and features

Variations - SNPs

Chr Start End Type Variation AA Change SNP IDs
11 100 -100 NS C/A T/N 1000GP (YRI, YRI, YRI, YRI, YRI)
11 100 -100 SYN A/G S/S 1000GP (YRI, YRI, YRI, YRI, YRI)
11 5,489,054 5,489,054 SYN A/G S/S 1000GP (CEU, CHBJPT)
11 5,489,111 5,489,111 SYN C/T Y/Y 1000GP (CEU, CHBJPT)
11 5,489,176 5,489,176 NS C/G A/G 1000GP (CHBJPT)
11 5,489,181 5,489,181 NS G/T V/F 1000GP (CHBJPT)
11 5,489,196 5,489,196 NS T/A F/I 1000GP (CHBJPT)
11 5,489,267 5,489,267 SYN T/C I/I 1000GP (CEU, CHBJPT)
11 5,489,368 5,489,368 NS A/T Y/F 1000GP (CEU)
11 5,489,396 5,489,396 SYN T/C H/H 1000GP (CEU, CHBJPT)
11 5,489,458 5,489,458 NS T/C I/T 1000GP (CEU, CHBJPT)
11 5,510,284 5,510,284 SYN G/A S/S rs417425 (DbSNP)
11 5,510,341 5,510,341 SYN T/C Y/Y rs404280 (DbSNP)
11 5,510,396 5,510,396 NS C/T R/C rs7935144 (DbSNP)
11 5,510,424 5,510,426 Del(3) -/TCT rs35986511 (DbSNP)
11 5,510,430 5,510,432 In-Del(3) -/AAG rs58704672 (DbSNP)
11 5,510,497 5,510,497 SYN C/T I/I rs2467219 (DbSNP)
11 5,510,542 5,510,541 Ins(4) -/GGCT rs72233167 (DbSNP)
11 5,510,543 5,510,542 Ins(4) -/CTGG rs36066208 (DbSNP)
11 5,510,546 5,510,545 Ins(4) -/GGCT rs71991809 (DbSNP)
11 5,510,575 5,510,575 NS A/T E/D rs7924754 (DbSNP)
11 5,510,598 5,510,598 NS A/T Y/F rs7950082 (DbSNP)
11 5,510,626 5,510,626 SYN T/C H/H rs444878 (DbSNP)
11 5,510,688 5,510,688 NS C/T T/I rs7101919 (DbSNP)
11 5,510,846 5,510,846 NS C/T R/W rs11037758 (DbSNP)

Variations - CNVs

Chr Start End Type Sources
11 5,505,764 6,194,475 CopyNumber Variation_34458 (DGV)

Haplotypes

Protein haplotypes were calculated using the 1000 genomes project as described in Olender T. et. al. BMC Genomics 2012.

T137N R154C D213E Y221F I251T % Freq CORP
1 T R D Y I 70.51 0.038
2 T R D Y T 18.43 0.068
3 T R D F I 8.60 1.000
4 T C E Y I 2.00 0.017
5 N R D Y I 0.46 0.038

AceView Gene Models

The information is based on AceView gene models, constructed from cDNA sequences. The information might be incomplete.

Accession Type Chr Start End Strand
OR52D1.aApr07-unspliced main_exon CDS chr11 5,488,707 5,489,660 +
3UTR chr11 5,489,660 5,489,663 +