Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

OR52E2 Olfactory Receptor

Gene Symbol OR52E21 (View this gene in GeneCards)
Family 52
Subfamily E
Pseudogene No
CORP pseudogene probability score 0.62 (pseudogene)
Aliases HsOR11.3.44, ORL3372
External Ids HGNC: 14769   GeneBank: AB065800, NM_001005164   ORDB: ORL3372   
Build #39 labels OR52E2
Chromosomal location 11:5,058,653-5,059,627 (-)
Cluster 11@5
Synteny CLIC#23
Remarks

Most Similar ORs in Humans (Paralogs)

Symbol Percent Length
OR52E3P 84.24% 311

Most Similar ORs in other species (Orthologs)

Specie Symbol Percent Length
Dog OR52E2B 86% 311
Dog OR52E2 86% 311
Chimp CONTIG465.109-1496 98% 325
Mouse Or52e2 84% 317
Mouse Or52e3 83% 311
Rat Or52e2 83% 317
Rat Or52e3 84% 311
Cow OR52E2P 84% 314
Cow OR52E3 84% 311

Sequence information

Nucleotide sequence ATGTTCCTTCCCAATGACACCCAGTTTCACCCCTCCTCCTTCCTGTTGCTGGGGATCCCA
GGACTAGAAACACTTCACATCTGGATCGGCTTTCCCTTCTGTGCTGTGTACATGATCGCA
CTCATAGGGAACTTCACTATTCTACTTGTGATCAAGACTGACAGCAGCCTACACCAGCCC
ATGTTCTACTTCCTGGCCATGTTGGCCACCACTGATGTGGGTCTCTCAACAGCTACCATC
CCTAAGATGCTTGGAATCTTCTGGATCAACCTCAGAGGGATCATCTTTGAAGCCTGCCTC
ACCCAGATGTTTTTTATCCACAACTTCACACTTATGGAGTCAGCAGTCCTTGTGGCAATG
GCTTATGACAGCTATGTGGCCATCTGCAATCCACTCCAATATAGCGCCATCCTCACCAAC
AAGGTTGTTTCTGTGATTGGTCTTGGTGTGTTTGTGAGGGCTTTAATTTTCGTCATTCCC
TCTATACTTCTTATATTGCGGTTGCCCTTCTGTGGGAATCATGTAATTCCCCACACCTAC
TGTGAGCACATGGGTCTTGCTCATCTATCTTGTGCCAGCATCAAAATCAATATTATTTAT
GGTTTATGTGCCATTTGTAATCTAGTGTTTGACATCACAGTCATTGCCCTTTCTTATGTG
CATATTCTTTGTGCTGTTTTCCGTCTTCCTACTCATGAAGCCCGACTCAAGTCCCTCAGC
ACATGTGGTTCACATGTGTGTGTAATCCTTGCCTTCTATACACCAGCCCTCTTTTCCTTT
ATGACTCATCGCTTTGGCCGAAATGTGCCCCGCTATATCCATATACTCCTAGCCAATCTC
TATGTTGTGGTGCCACCAATGCTCAATCCTGTCATATATGGAGTCAGAACCAAGCAGATC
TATAAATGTGTGAAGAAAATATTATTGCAGGAACAAGGAATGGAAAAGGAAGAGTACCTA
ATACATACGAGGTTC
Conceptual translation MFLPNDTQFHPSSFLLLGIPGLETLHIWIGFPFCAVYMIALIGNFTILLVIKTDSSLHQP
MFYFLAMLATTDVGLSTATIPKMLGIFWINLRGIIFEACLTQMFFIHNFTLMESAVLVAM
AYDSYVAICNPLQYSAILTNKVVSVIGLGVFVRALIFVIPSILLILRLPFCGNHVIPHTY
CEHMGLAHLSCASIKINIIYGLCAICNLVFDITVIALSYVHILCAVFRLPTHEARLKSLS
TCGSHVCVILAFYTPALFSFMTHRFGRNVPRYIHILLANLYVVVPPMLNPVIYGVRTKQI
YKCVKKILLQEQGMEKEEYLIHTRF

Protein domains and features

Variations - SNPs

Chr Start End Type Variation AA Change SNP IDs
11 5,080,068 5,080,068 NS A/G C/R rs2500052 (DbSNP)
11 5,080,181 5,080,181 NS A/G V/A rs72873928 (DbSNP)
11 5,080,359 5,080,359 NS A/G W/R rs11035396 (DbSNP)
11 5,080,844 5,080,844 NS C/T S/N rs16909440 (DbSNP)
11 5,080,337 5,080,337 NS C/T R/H rs61746343 (DbSNP)
11 5,079,984 5,079,984 NS T/C I/V rs61995745 (DbSNP)
11 5,080,234 5,080,234 SYN C/T L/L rs2445333 (DbSNP)
11 5,079,946 5,079,946 SYN C/T V/V rs2445332 (DbSNP)
11 5,080,591 5,080,591 SYN G/T I/I rs12576484 (DbSNP)
11 5,058,951 5,058,951 NS A/G V/A 1000GP (CEU)
11 5,058,838 5,058,838 NS G/A R/C 1000GP (CEU, CHBJPT)
11 5,059,004 5,059,004 SYN T/C L/L 1000GP (CEU, CHBJPT)
11 5,059,107 5,059,107 NS T/C H/R 1000GP (CEU, CHBJPT)
11 5,059,614 5,059,614 NS T/C N/S 1000GP (CEU, CHBJPT)
11 5,059,503 5,059,503 NS A/G I/T 1000GP (CEU)
11 5,058,716 5,058,716 SYN C/T V/V 1000GP (CEU, CHBJPT)
11 5,059,129 5,059,129 NS G/A R/W 1000GP (CEU, CHBJPT)
11 100 -100 SYN C/T V/V 1000GP (YRI, YRI, YRI)
11 100 -100 NS G/A R/C 1000GP (YRI, YRI, YRI, YRI, YRI, YRI)

Variations - CNVs

Chr Start End Type Sources
11 4,907,893 5,135,331 CopyNumber Variation_3835 (DGV)

Haplotypes

Protein haplotypes were calculated using the 1000 genomes project as described in Olender T. et. al. BMC Genomics 2012.

I292V R264C M261V V226A H174R R167W G147D A69T N5S % Freq CORP
1 I R M V H R G A S 30.18 0.670
2 I C M V H R G A N 24.58 0.670
3 I C M V R R G A N 19.35 0.670
4 I R M V H R G A N 11.98 0.670
5 I R M V H W G A N 9.29 0.670
6 V C M V H R G A N 1.61 0.670
7 I C V V H R G A N 1.00 0.670
8 I C M A R R G A N 0.77 0.872
9 I R M V H R D A S 0.61 0.670
10 I C M V R R G T N 0.31 0.134
11 I C M V H R G A S 0.15 0.670
12 I C V V R R G A N 0.08 0.670
13 I C M V R R G A S 0.08 0.670

AceView Gene Models

The information is based on AceView gene models, constructed from cDNA sequences. The information might be incomplete.

Accession Type Chr Start End Strand
OR52E2.aApr07-unspliced main_exon 3UTR chr11 5,058,650 5,058,653 -
CDS chr11 5,058,653 5,059,627 -