Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

OR52E3P Olfactory Receptor

Gene Symbol OR52E3P1 (View this gene in GeneCards)
Family 52
Subfamily E
Pseudogene Yes
CORP pseudogene probability score
Aliases HsOR11.3.47P, ORL3496
External Ids HGNC: 14793   GeneBank: NG_002269   ORDB: ORL3496   
Build #39 labels OR52E3P
Chromosomal location 11:5,092,676-5,093,608 (+)
Cluster 11@5
Synteny CLIC#23
Remarks

Most Similar ORs in Humans (Paralogs)

Symbol Percent Length
OR52E2 84.24% 311

Most Similar ORs in other species (Orthologs)

Specie Symbol Percent Length
Dog OR52E2B 84% 311
Dog OR52E2 83% 311
Chimp CONTIG465.103-3119 96% 311
Mouse Or52e3 86% 311
Rat Or52e3 85% 311
Cow OR52E3 84% 311
Cow OR52E2P 82% 308
Cow OR52E3BP 81% 305
Cow OR52E57 80% 285

Sequence information

Nucleotide sequence ATGTTCCTTCCCAATAACACCCAGTTTCACCCCTCCTCCTTCCTGTTGCTGGGGATCCCA
GGGCTAGAAACACTTCACATCTGGATCGGCTTTCCCTTTTGTGCTGTGTACATAATTGCA
CTCATAGGGCGCTTCACTATTCTACTTGTGATCAAGACTGACAGCAGCCTATACCAGCCC
ATGTTCTACTTCCTGGCCATGTTGGCCACCATTGACTTGGGCCTTTCAACAGCTACCATC
CCTAAGATGCTTGGGATCTTCTGGTTTAGCCTCAGGGAGATTATCTGTGATGCCTGCCTC
ATCCAGATGTTTTTCATCCACAACTTTACTGGCATGGAGTCAGCAGCCCTCGTGGGAATG
GCTTATGACCACTTTGTGGCCATCTGCAACCCGCTACGATATAGCATCATCCTCACCAAA
AAGGCTGTTTCTGTGATTGGTCTTGGTGTGTTAGTGAGGTCATTTATGTCTGTTATTCCA
TTTGTTTTTCTCATTTTGCGGTTGCCCTTCTGTGGGGATCATGTCATTCCCCACACCAAC
TGTGAGCACATGGGTCTTGCTCATCTGTCTTGTTCCAGTATCAAGATCAATATAATCTAT
GGCTTGGGTGCTATTTCAATCCTAGTATTCGACATCATAGCCATTGCCCTTTCTTATGTG
CAAATACTTCACGCTGTTTTCCATCTTCCTTCCTGTAAAGCCTGACTCAAGTCCCTCAGC
ACATGTGGTTCACATGTGTGTGTAATCCTTGCCTTCTATACACCAGCCCTCTTTTCCTTT
GTGACTCATCGCTTTGGCCAAAATGTGCCCCGCTATATCCATATACTCCTAGCCAATCTC
TATGTTGTGGTGCCACCAATGCTCAATCCTGTCATATATGGAGTCAGAACCAAGCAGATC
TATGACTGTGTGAAGAAAATATTCTTACAAAAA
Conceptual translation MFLPNNTQFHPSSFLLLGIPGLETLHIWIGFPFCAVYIIALIGRFTILLVIKTDSSLYQP
MFYFLAMLATIDLGLSTATIPKMLGIFWFSLREIICDACLIQMFFIHNFTGMESAALVGM
AYDHFVAICNPLRYSIILTKKAVSVIGLGVLVRSFMSVIPFVFLILRLPFCGDHVIPHTN
CEHMGLAHLSCSSIKINIIYGLGAISILVFDIIAIALSYVQILHAVFHLPSCKAXKSLS
TCGSHVCVILAFYTPALFSFVTHRFGQNVPRYIHILLANLYVVVPPMLNPVIYGVRTKQI
YDCVKKIFLQK

Protein domains and features

Variations - SNPs

Chr Start End Type Variation AA Change SNP IDs
11 5,114,762 5,114,762 SNP A/C rs73394862 (DbSNP)
11 5,114,211 5,114,211 SNP T/G rs1551489 (DbSNP)
11 5,092,981 5,092,981 SNP G/T 1000GP (CEU)
11 5,093,189 5,093,189 SNP G/A 1000GP (CEU)
11 5,093,281 5,093,281 SNP G/T 1000GP (CEU, CHBJPT)
11 5,093,348 5,093,348 SNP G/A 1000GP (CHBJPT)
11 100 -100 SNP T/C 1000GP (YRI, YRI)

Variations - CNVs

Chr Start End Type Sources
11 4,907,893 5,135,331 CopyNumber Variation_3835 (DGV)
11 5,087,292 5,125,991 CopyNumber Variation_5421 (DGV)
11 5,113,806 5,116,838 Deletion #197 (Waszak)

Haplotypes

Protein haplotypes were calculated using the 1000 genomes project as described in Olender T. et. al. BMC Genomics 2012.