Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

OR52E4 Olfactory Receptor

Gene Symbol OR52E41 (View this gene in GeneCards)
Family 52
Subfamily E
Pseudogene No
CORP pseudogene probability score 0.02 (functional)
Aliases OR11-55, HsOR11.3.87, ORL3293
External Ids HGNC: 15213   GeneBank: AB065817, BK004302, NM_001005165   ORDB: ORL3293   
Build #39 labels OR52E4
Chromosomal location 11:5,884,293-5,885,228 (+)
Cluster 11@6
Synteny CLIC#23
Remarks

Most Similar ORs in Humans (Paralogs)

Symbol Percent Length
OR52E2 68.83% 308
OR52E3P 69.71% 307
OR52E8 69.03% 310

Most Similar ORs in other species (Orthologs)

Specie Symbol Percent Length
Dog OR52E4B 90% 311
Dog OR52E4 89% 311
Chimp CONTIG*********** 99% 312
Mouse Or52e4 86% 312
Rat Or52e4 87% 312
Cow OR52E4 90% 309

Expression evidences

Source Accession
mRNA BC136972

Sequence information

Nucleotide sequence ATGCCTTCTATCAATGACACCCACTTCTATCCCCCCTTCTTCCTCCTGCTAGGAATACCA
GGACTGGACACTTTACATATCTGGATTTCTTTCCCATTCTGTATTGTGTACCTGATTGCC
ATTGTGGGGAATATGACCATTCTCTTTGTGATCAAAACTGAACATAGTCTACACCAGCCC
ATGTTCTACTTCCTGGCCATGTTGTCTATGATTGATCTGGGTCTGTCCACATCCACTATC
CCCAAAATGCTAGGAATCTTCTGGTTCAACCTCCAAGAGATCAGCTTTGGGGGATGCCTT
CTTCAGATGTTCTTTATTCACATGTTTACAGGCATGGAGACTGTTCTGTTGGTGGTCATG
GCTTATGACCGCTTTGTTGCCATCTGCAACCCTCTCCAGTACACCATGATCCTCACCAAT
AAAACCATCAGTATCCTAGCTTCTGTGGTTGTTGGAAGAAATTTAGTTCTTGTAACCCCA
TTTGTGTTTCTCATTCTGCGTCTGCCATTCTGTGGGCATAACATCGTACCTCACACATAC
TGTGAGCACAGGGGTCTGGCCGGGTTGGCCTGTGCACCCATTAAGATCAACATAATCTAT
GGGCTCATGGTGATTTCTTATATTATTGTGGATGTGATCTTAATTGCCTCTTCCTATGTG
CTTATCCTTAGAGCTGTTTTTCGCCTTCCCTCTCAAGATGTCCGACTAAAGGCCTTCAAT
ACCTGTGGTTCTCATGTCTGTGTTATGCTGTGCTTTTACACACCAGCATTTTTTTCTTTT
ATGACACATCGTTTTGGCCAAAACATTCCCCACTATATCCATATTCTTTTGGCTAACCTG
TATGTGGTTGTCCCACCTGCCCTTAACCCTGTCATTTATGGAGTCAGGACCAAGCAGATC
CGAGAGCAAATTGTGAAAATATTTGTACAGAAAGAA
Conceptual translation MPSINDTHFYPPFFLLLGIPGLDTLHIWISFPFCIVYLIAIVGNMTILFVIKTEHSLHQP
MFYFLAMLSMIDLGLSTSTIPKMLGIFWFNLQEISFGGCLLQMFFIHMFTGMETVLLVVM
AYDRFVAICNPLQYTMILTNKTISILASVVVGRNLVLVTPFVFLILRLPFCGHNIVPHTY
CEHRGLAGLACAPIKINIIYGLMVISYIIVDVILIASSYVLILRAVFRLPSQDVRLKAFN
TCGSHVCVMLCFYTPAFFSFMTHRFGQNIPHYIHILLANLYVVVPPALNPVIYGVRTKQI
REQIVKIFVQKE

Protein domains and features

Variations - SNPs

Chr Start End Type Variation AA Change SNP IDs
11 5,906,205 5,906,205 NS A/G H/R rs4757987 (DbSNP)
11 5,906,117 5,906,117 NS A/G I/V rs61876191 (DbSNP)
11 5,906,048 5,906,048 NS A/G I/V rs4758168 (DbSNP)
11 5,906,291 5,906,291 NS C/T L/F rs11823842 (DbSNP)
11 5,906,203 5,906,203 NS G/T L/F rs11823828 (DbSNP)
11 5,905,669 5,905,669 NS G/T L/F rs16914094 (DbSNP)
11 5,906,073 5,906,073 NS G/T R/M rs4757986 (DbSNP)
11 5,906,192 5,906,192 SYN C/A R/R rs1453435 (DbSNP)
11 5,906,143 5,906,143 SYN C/T Y/Y rs11823809 (DbSNP)
11 5,884,975 5,884,975 NS G/A R/H 1000GP (CEU, CHBJPT)
11 5,884,818 5,884,818 NS G/A V/I 1000GP (CEU, CHBJPT)
11 5,884,973 5,884,973 NS T/G F/L 1000GP (CEU, CHBJPT)
11 5,885,061 5,885,061 NS T/C F/L 1000GP (CEU, CHBJPT)
11 5,884,843 5,884,843 NS G/T R/M 1000GP (CEU, CHBJPT)
11 5,884,962 5,884,962 SYN A/C R/R 1000GP (CEU, CHBJPT)
11 5,884,913 5,884,913 SYN T/C Y/Y 1000GP (CEU, CHBJPT)
11 100 -100 NS T/G F/L 1000GP (YRI, YRI, YRI, YRI, YRI, YRI, YRI)
11 100 -100 SYN T/C Y/Y 1000GP (YRI, YRI, YRI)

Variations - CNVs

Chr Start End Type Sources
11 5,868,055 6,007,613 CopyNumber Variation_2903 (DGV)
11 5,730,377 5,970,717 CopyNumber Variation_3836 (DGV)
11 5,885,711 5,969,185 CopyNumber Variation_8676 (DGV)
11 5,885,711 5,934,044 CopyNumber Variation_8677 (DGV)
11 5,899,885 5,935,103 CopyNumber Variation_9650 (DGV), Variation_48860 (DGV), Variation_53917 (DGV)
11 5,899,885 5,935,102 CopyNumber Variation_29603 (DGV)
11 5,883,376 5,935,626 CopyNumber Variation_30541 (DGV)
11 5,505,764 6,194,475 CopyNumber Variation_34458 (DGV)
11 5,885,709 5,935,510 CopyNumber Variation_37668 (DGV)
11 5,875,867 5,935,103 CopyNumber Variation_48859 (DGV)
11 5,899,885 5,959,757 CopyNumber Variation_53792 (DGV)
11 5,871,831 5,935,103 CopyNumber Variation_53856 (DGV)
11 5,905,423 5,908,458 CopyNumber #134 (Waszak)

Haplotypes

Protein haplotypes were calculated using the 1000 genomes project as described in Olender T. et. al. BMC Genomics 2012.

P12H I39M F49L V176I R184M I199V F257L T262I R301Q % Freq CORP
1 P I F I M I F T R 43.63 0.031
2 P I F I M I L T R 35.02 0.031
3 P I F V R I F T R 17.59 0.031
4 P I L V R I F T R 1.92 0.031
5 P M F I M I L T R 0.69 0.031
6 P I F I M I L T Q 0.31 0.031
7 P I F I M V F T R 0.23 0.031
8 H I F V R I F T R 0.15 0.031
9 P I F I R I L T R 0.15 0.031
10 P I F V M I F T R 0.08 0.031
11 P I F I M I F I R 0.08 0.031
12 P I F I R I F T R 0.08 0.031
13 P I F V R I L T R 0.08 0.031

AceView Gene Models

The information is based on AceView gene models, constructed from cDNA sequences. The information might be incomplete.

Accession Type Chr Start End Strand
OR52E4.aApr07-unspliced main_exon CDS chr11 5,884,293 5,885,228 +
3UTR chr11 5,885,228 5,885,231 +