Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

OR52E5 Olfactory Receptor

Gene Symbol OR52E51 (View this gene in GeneCards)
Family 52
Subfamily E
Pseudogene No
CORP pseudogene probability score 0.92 (pseudogene)
Aliases OR11-56, HsOR11.3.88, ORL3294
External Ids HGNC: 15214   GeneBank: AB065536, BK004566, NM_001005166   ORDB: ORL3294   
Build #39 labels OR52E5
Chromosomal location 11:5,900,777-5,901,757 (+)
Cluster 11@6
Synteny CLIC#23
Remarks

Most Similar ORs in Humans (Paralogs)

Symbol Percent Length
OR52E2 67.86% 308
OR52E4 68.08% 307
OR52E8 67.75% 307

Most Similar ORs in other species (Orthologs)

Specie Symbol Percent Length
Dog OR52E25 88% 210
Chimp CONTIG*********** 95% 329
Mouse Or52e5 87% 210
Rat Or52e5 87% 210
Rat Or52e5b 86% 210
Cow OR52E25 88% 313

Sequence information

Nucleotide sequence ATGCTTCATACCAACAATACACAGTTTCACCCTTCCACCTTCCTCGTAGTGGGGGTCCCA
GGGCTGGAAGATGTGCATGTATGGATTGGCTTCCCCTTCTTTGCAGTGTATCTAACAGCC
CTTCTAGGGAACATCATTATCCTGTTTGTGATACAGACTGAACAGAGCCTCCACCAACCC
ATGTTTTACTTCCTAGCCATGTTGGCCGGCACTGATCTGGGCTTGTCTACAGCAACCATC
CCCAAGATGCTGGGAATTTTCTGGTTTAATCTTGGAGAGATTGCATTTGGTGCCTGCATC
ACACAGATGTATACCATTCATATATGCACTGGCCTGGAGTCTGTGGTACTGACAGTCACG
GGCATAGATCGCTATATTGCCATCTGCAACCCCCTGAGATATAGCATGATCCTTACCAAC
AAGGTAATAGCCATTCTGGGCATAGTCATCATTGTCAGGACTTTGGTATTTGTGACTCCA
TTCACATTTCTCATCCTGAGATTGCCTTTCTGTGGTGTCCGGATTATCCCTCATACCTAT
TGTGAACACATGGGCTTGGCAAAGTTAGCTTGTGCCAGTATTAATGTTATATATGGATTG
ATTGCCTTCTCAGTGGGATACATTGACATTTCTGTGATTGGATTTTCCTATGTCCAGATC
CTCCGAGCTGTCTTCCATCTCCCAGCCTGGGATGCCCGGCCTAAGGCACTCAGCACATGT
GGCTCTCACGTCTGTGTTATGTTGGCTTTCTACCTGCCAGCCCTCTTTTCCTTCATGACA
CACCGCTTTGGCCACAACATCCCTCATTACATCCACATTCTTCTGGCCAATCTGTATGTG
GTTTTTCCCCCTGCTCTTAACTCTGTTATCTATGGGGTCAAAACAAAACAGATACGAGAG
CAGGTACTTAGGATACTCAACCCTAAAAGCTTTTGGCATTTTGACCCCAAGAGGATCTTC
CACAACAATTCAGTTAGACAA
Conceptual translation MLHTNNTQFHPSTFLVVGVPGLEDVHVWIGFPFFAVYLTALLGNIIILFVIQTEQSLHQP
MFYFLAMLAGTDLGLSTATIPKMLGIFWFNLGEIAFGACITQMYTIHICTGLESVVLTVT
GIDRYIAICNPLRYSMILTNKVIAILGIVIIVRTLVFVTPFTFLILRLPFCGVRIIPHTY
CEHMGLAKLACASINVIYGLIAFSVGYIDISVIGFSYVQILRAVFHLPAWDARPKALSTC
GSHVCVMLAFYLPALFSFMTHRFGHNIPHYIHILLANLYVVFPPALNSVIYGVKTKQIRE
QVLRILNPKSFWHFDPKRIFHNNSVRQ

Protein domains and features

Variations - SNPs

Chr Start End Type Variation AA Change SNP IDs
11 100 -100 NS C/A Q/K 1000GP (YRI, YRI, YRI, YRI, YRI)
11 100 -100 SYN C/T A/A 1000GP (YRI, YRI, YRI)
11 5,900,992 5,900,992 SYN T/C D/D 1000GP (CEU, CHBJPT)
11 5,901,063 5,901,063 NS T/G F/C 1000GP (CEU)
11 5,901,136 5,901,136 SYN G/A T/T 1000GP (CHBJPT)
11 5,901,270 5,901,270 NS T/C I/T 1000GP (CEU, CHBJPT)
11 5,901,402 5,901,402 NS A/G D/G 1000GP (CEU, CHBJPT)
11 5,901,477 5,901,477 NS C/T P/L 1000GP (CEU, CHBJPT)
11 5,922,222 5,922,222 SYN C/T D/D rs10160336 (DbSNP)
11 5,922,366 5,922,366 SYN A/G T/T rs16926729 (DbSNP)
11 5,922,500 5,922,500 NS C/T T/I rs17234326 (DbSNP)
11 5,922,632 5,922,632 NS A/G D/G rs16926732 (DbSNP)
11 5,922,707 5,922,707 NS C/T P/L rs7106300 (DbSNP)

Variations - CNVs

Chr Start End Type Sources
11 5,505,764 6,194,475 CopyNumber Variation_34458 (DGV)
11 5,730,377 5,970,717 CopyNumber Variation_3836 (DGV)
11 5,868,055 6,007,613 CopyNumber Variation_2903 (DGV)
11 5,871,831 5,935,103 CopyNumber Variation_53856 (DGV)
11 5,875,867 5,935,103 CopyNumber Variation_48859 (DGV)
11 5,883,376 5,935,626 CopyNumber Variation_30541 (DGV)
11 5,885,709 5,935,510 CopyNumber Variation_37668 (DGV)
11 5,885,711 5,934,044 CopyNumber Variation_8677 (DGV)
11 5,885,711 5,969,185 CopyNumber Variation_8676 (DGV)
11 5,899,885 5,935,102 CopyNumber Variation_29603 (DGV)
11 5,899,885 5,935,103 CopyNumber Variation_9650 (DGV), Variation_48860 (DGV), Variation_53917 (DGV)
11 5,899,885 5,959,757 CopyNumber Variation_53792 (DGV)
11 5,921,129 5,963,801 CopyNumber Variation_6928 (DGV)
11 5,921,907 5,924,987 CopyNumber #135 (Waszak)

Haplotypes

Protein haplotypes were calculated using the 1000 genomes project as described in Olender T. et. al. BMC Genomics 2012.

F96C Q102K I143V I165T A192D D209G P234L R262H % Freq CORP
1 F Q I I A D L R 76.50 0.895
2 F Q I T A D L R 11.52 0.895
3 F Q I I A D P R 5.76 0.895
4 F Q I T A G L R 2.00 0.791
5 F Q V I A D L R 1.38 0.895
6 C Q I I A D P R 1.08 0.895
7 F Q I I A D L H 1.08 0.895
8 F K I I A D L R 0.54 0.984
9 F Q I I A G L R 0.08 0.791
10 F Q I I D D L R 0.08 0.895