Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

OR52E6 Olfactory Receptor

Gene Symbol OR52E61 (View this gene in GeneCards)
Family 52
Subfamily E
Pseudogene No
CORP pseudogene probability score
Aliases OR11-58, HsOR11.3.84, ORL3386
External Ids HGNC: 15215   GeneBank: AB065815, AF399504, BK004304, NM_001005167   ORDB: ORL3386   
Build #39 labels OR52E6
Chromosomal location 11:5,840,959-5,841,897 (-)
Cluster 11@6
Synteny CLIC#23
Remarks

Most Similar ORs in Humans (Paralogs)

Symbol Percent Length
OR52E8 89.14% 313

Most Similar ORs in other species (Orthologs)

Specie Symbol Percent Length
Dog OR52E8 87% 312
Dog OR52E8C 86% 312
Dog OR52E8D 83% 310
Chimp CONTIG*********** 98% 313
Mouse Or52e8b 82% 313
Mouse Or52e8 81% 313
Rat Or52e8b 82% 313
Rat Or52e8 81% 312
Cow OR52E8 82% 309

Expression evidences

Source Accession
ESTs EG357698

Sequence information

Nucleotide sequence ATGCCTATAGCTAACGACACCCAGTTCCATACTTCTTCATTCCTACTGCTGGGTATCCCA
GGGCTAGAAGATGTGCACATCTGGATTGGATTCCCTTTTTTCTCTGTGTATCTTATTGCA
CTCCTGGGAAATGCTGCTATCTTCTTTGTGATCCAAACTGAGCAGAGTCTCCATGAGCCC
ATGTACTACTGCCTGGCCATGTTGGATTCCATTGACCTGAGCTTGTCTACGGCCACCATT
CCCAAAATGCTGGGCATCTTCTGGTTCAATATCAAGGAAATATCTTTTGGAGGCTACCTT
TCTCAGATGTTCTTCATCCATTTCTTCACTGTCATGGAGAGCATCGTATTGGTGGCCATG
GCCTTTGACCGCTACATTGCCATTTGCAAACCTCTTTGGTACACCATGATCCTCACCAGC
AAAATCATCAGCCTCATTGCAGGCATTGCTGTCCTGAGGAGCTTGTACATGGTCATTCCA
CTGGTGTTTCTCCTCTTAAGGTTGCCCTTCTGTGGACATCGTATCATCCCTCATACTTAC
TGTGAGCACATGGGCATTGCCCGTCTGGCCTGTGCCAGCATCAAAGTCAACATTATGTTT
GGTCTTGGCAGTATTTCTCTCTTGTTATTGGATGTGCTCCTTATTATTCTCTCCCATATC
AGGATCCTCTATGCTGTCTTCTGCCTGCCCTCCTGGGAAGCTCGACTCAAAGCTCTCAAC
ACCTGTGGCTCTCACATTGGTGTTATCTTAGCCTTTTCTACACCAGCATTTTTCTCTTTC
TTTACACACTGCTTTGGCCATGATATTCCCCAATATATCCACATTTTCTTGGCTAATCTA
TATGTGGTTGTTCCTCCCACCCTCAATCCTGTAATCTATGGGGTCAGAACCAAACATATT
AGGGAGACAGTGCTGAGGATTTTCTTCAAGACAGATCAC
Conceptual translation MPIANDTQFHTSSFLLLGIPGLEDVHIWIGFPFFSVYLIALLGNAAIFFVIQTEQSLHEP
MYYCLAMLDSIDLSLSTATIPKMLGIFWFNIKEISFGGYLSQMFFIHFFTVMESIVLVAM
AFDRYIAICKPLWYTMILTSKIISLIAGIAVLRSLYMVIPLVFLLLRLPFCGHRIIPHTY
CEHMGIARLACASIKVNIMFGLGSISLLLLDVLLIILSHIRILYAVFCLPSWEARLKALN
TCGSHIGVILAFSTPAFFSFFTHCFGHDIPQYIHIFLANLYVVVPPTLNPVIYGVRTKHI
RETVLRIFFKTDH

Protein domains and features

Variations - SNPs

Chr Start End Type Variation AA Change SNP IDs
11 5,862,937 5,862,937 NS A/C F/C rs4495918 (DbSNP)
11 5,862,532 5,862,532 NS A/C M/R rs10742809 (DbSNP)
11 5,862,731 5,862,731 NS A/G W/R rs10838719 (DbSNP)
11 5,862,845 5,862,845 NS A/G S/P rs4592451 (DbSNP)
11 5,862,619 5,862,619 NS A/T F/Y rs7943698 (DbSNP)
11 5,862,984 5,862,984 NS C/G L/F rs10769272 (DbSNP)
11 5,862,965 5,862,965 NS C/G E/Q rs61739208 (DbSNP)
11 5,863,013 5,863,013 NS C/T V/I rs4362173 (DbSNP)
11 5,862,416 5,862,416 NS C/T A/T rs61735020 (DbSNP)
11 5,862,653 5,862,653 NS C/T V/I rs4357719 (DbSNP)
11 5,862,238 5,862,238 NS G/A T/I rs61739213 (DbSNP)
11 5,862,758 5,862,758 NS G/A R/C rs61737712 (DbSNP)
11 5,862,995 5,862,995 NS T/C T/A rs61737905 (DbSNP)
11 5,863,113 5,863,113 SYN A/G N/N rs10742810 (DbSNP)
11 5,862,780 5,862,780 SYN C/T V/V rs4362172 (DbSNP)
11 5,841,707 5,841,707 NS C/A C/F 1000GP (CEU, CHBJPT)
11 5,841,754 5,841,754 NS G/C F/L 1000GP (CEU, CHBJPT)
11 5,841,883 5,841,883 SYN G/A N/N 1000GP (CEU, CHBJPT)
11 5,841,615 5,841,615 NS A/G S/P 1000GP (CEU, CHBJPT)
11 5,841,302 5,841,302 NS A/C M/R 1000GP (CEU, CHBJPT)
11 5,841,501 5,841,501 NS A/G W/R 1000GP (CEU, CHBJPT)
11 5,841,423 5,841,423 NS T/C I/V 1000GP (CEU, CHBJPT)
11 5,841,783 5,841,783 NS T/C I/V 1000GP (CEU, CHBJPT)
11 5,841,550 5,841,550 SYN T/C V/V 1000GP (CEU, CHBJPT)
11 5,841,382 5,841,382 SYN T/C G/G 1000GP (CHBJPT)
11 100 -100 NS A/C M/R 1000GP (YRI, YRI, YRI, YRI, YRI, YRI, YRI, YRI)
11 100 -100 SYN T/C V/V 1000GP (YRI, YRI)

Variations - CNVs

Chr Start End Type Sources
11 5,730,377 5,970,717 CopyNumber Variation_3836 (DGV)
11 5,505,764 6,194,475 CopyNumber Variation_34458 (DGV)

Haplotypes

Protein haplotypes were calculated using the 1000 genomes project as described in Olender T. et. al. BMC Genomics 2012.

G298E A242T L233R Y228C M203R F174Y I163V W137R R128C G102R S99P T81M C68F Q59E F52L I43V % Freq CORP
1 G A L Y M F I W R G S T C Q F I 48.46 1.000
2 G A L Y R F V R R G P T F Q L V 32.26 1.000
3 G A L Y M F I R R G S T C Q F I 8.29 1.000
4 G A L Y M F V W R G P T F Q L V 4.07 1.000
5 G T L Y R F V R R G P T F Q L V 1.00 1.000
6 G A L Y M Y V W R G P T F Q L V 0.84 1.000
7 E A L Y M F I W R G S T C Q F I 0.69 1.000
8 G A L Y R F V W R G P T F Q L V 0.54 1.000
9 G A L Y M F V W C G P T F E L V 0.54 1.000
10 G A R Y M F V W R G P T F Q L V 0.38 1.000
11 G A L Y M F I W R R S T C Q F I 0.38 1.000
12 G A L Y R F V R R G P T F Q F I 0.23 1.000
13 G A L Y R F I W R G P T F Q L V 0.23 1.000
14 G A L Y M F V R R G P T F Q L V 0.23 1.000
15 G A L Y M F V W R G P T F Q L I 0.15 1.000
16 G A L Y R F I W R G S T C Q F I 0.15 1.000
17 G A L C M F V W R G P T F Q L V 0.15 1.000
18 G A L C R F V R R G P T F Q L V 0.15 1.000
19 G A L Y M F V R C G P T F E L V 0.15 1.000
20 G A L Y M F V R R G S T C Q F I 0.08 1.000
21 G A L Y M F V R R G S T F E L V 0.08 1.000
22 G A R Y M F V W R G S T F Q F I 0.08 1.000
23 G A L Y M F V W R G S T F Q F V 0.08 1.000
24 G A L Y M F I W R G S T F Q F I 0.08 1.000
25 G A L Y R F I R R G S T C Q F I 0.08 1.000
26 G A L Y R F V R R G P T C Q L V 0.08 1.000
27 G A L Y M Y V R R G P T F Q L V 0.08 1.000
28 G A L Y M F I R R G S M C Q F I 0.08 1.000
29 G A R Y M F V W R G P T F Q F I 0.08 1.000
30 G A L Y R F I R R G P T F Q L V 0.08 1.000
31 G A R Y M F V W R G S T F Q F V 0.08 1.000
32 G A L Y M F I W C G S T C Q F I 0.08 1.000
33 G A L Y M F I W R G S M C Q F I 0.08 1.000

AceView Gene Models

The information is based on AceView gene models, constructed from cDNA sequences. The information might be incomplete.

Accession Type Chr Start End Strand
OR52E6.aApr07-unspliced main_exon 3UTR chr11 5,840,928 5,840,959 -
CDS chr11 5,840,959 5,841,897 -