Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

OR52E7P Olfactory Receptor

Gene Symbol OR52E7P1 (View this gene in GeneCards)
Family 52
Subfamily E
Pseudogene Yes
CORP pseudogene probability score
Aliases OR11-52, OR11-53, HsOR11.3.86P, ORL3526
External Ids HGNC: 15216   GeneBank: BK004686, BK004687, NG_004223   ORDB: ORL3526   
Build #39 labels OR52E7P
Chromosomal location 11:5,873,960-5,874,888 (+)
Cluster 11@6
Synteny CLIC#23
Remarks

Most Similar ORs in Humans (Paralogs)

Symbol Percent Length
OR52E4 59.27% 302
OR52E6 63.91% 302
OR52E8 65.56% 302

Most Similar ORs in other species (Orthologs)

Specie Symbol Percent Length
Dog OR52E7 80% 302
Chimp CONTIG41614.1-570 96% 310
Mouse Or52e7 80% 303
Rat Or52e7 79% 306
Cow OR52E7 82% 302

Expression evidences

Source Accession
ESTs BQ432782

Sequence information

Nucleotide sequence ATGTCTTCTCCCAATGTCACTGAACCCCACCTCTCTTCCTTCCTGTTGGTTAGGAATTCC
AGGATTGGAAGCTGCACAACGCTGGCTAGGCTTTCCCTTCTGTGTTGTATATCTGATTGC
TCTTGTTGGAAATCTTATCATTCTATTTGTTATCTGGACTGATAAAAACCTTCACCAACC
CATGTTCTACTTTCTGGCCATGCTGTCAGTCATGACCTGAGTCTTTCTACATCTACTATC
CCCAAGATGTTGGGCATCTTCTGGTTCAGCCTTCAGGAGTTGTGCTTTGGGTGCTGTGTT
GCTCAAGTCTTTTTTATCCATTTTTTTTGCAGTCATGGAGAGCATTGTACTTCTTGTCAT
GGGATTTGATCGCTATGTGGCTATTTGCAACCCCTTCAGGTAGACCAAGATCCTCACCAA
CAGAATTACTGGTGTGATTGCTATGGTTGTGGTTCTTAGAAGCTTATGTATGATTGCTCC
CATCATTTTTCTCCTCATGAGGCTGCCTTACTGTGGACATAGAATCATCCCTTATACCTA
TTGTGAGCACATGGGAGTGGCTCGTCTGGCTTGTGCCAGCATCAGTGTCAATGTCTCTCA
TGGTCTTGGGAATATTTTTATCTTGTTTCTGGATATGTTTCTTATCATCATCTCCTATGC
TAGAATTTTATGCACAGTCTTTCACCTCCCTTCCCAAGAGGCCCACCTGAAGGCTCTTAA
TACCTGTAGCTCCCATATCTGTGTCATCTTAGCATTTTTTGGCCCAGCTCTCTTCTCCTT
TCTCACTCATCGCTTTGGTCATGGCATCCCACAGTATATCCATATTCTCCTGGCTAATCT
CTATATATAGTCATTCCCCCTGCTCTTAACCCAGTCATTTATGGAGTTAGGACCAAGCAA
ATCCAGGAGCGGGTAGAAAGTCTCTTTAC
Conceptual translation MSSPNVTEPHLSSFLL\GIPGLEAAQRWLGFPFCVVYLIALVGNLIILFVIWTDKNLHQ
PMFYFLAMLSV/DLSLSTSTIPKMLGIFWFSLQELCFGCCVAQVFFIHFF\VMESIVL
LVMGFDRYVAICNPFRXKILTNRITGVIAMVVVLRSLCMIAPIIFLLMRLPYCGHRIIP
YTYCEHMGVARLACASISVNVSHGLGNIFILFLDMFLIIISYARILCTVFHLPSQEAHLK
ALNTCSSHICVILAFFGPALFSFLT/SLWSWHPTVYPYSPGXLYIVIPPALNPVIYGV
RTKQI/GAGRKSLY

Protein domains and features

Variations - SNPs

Chr Start End Type Variation AA Change SNP IDs
11 5,895,414 5,895,414 SNP C/T rs10838770 (DbSNP)
11 5,895,754 5,895,754 SNP C/T rs10838772 (DbSNP)
11 5,895,618 5,895,618 SNP C/T rs7395997 (DbSNP)
11 5,874,184 5,874,184 SNP T/C 1000GP (CEU, CHBJPT)
11 5,874,388 5,874,388 SNP C/T 1000GP (CEU, CHBJPT)
11 5,874,524 5,874,524 SNP T/C 1000GP (CEU, CHBJPT)
11 5,874,682 5,874,682 SNP C/T 1000GP (CEU)
11 100 -100 SNP A/G 1000GP (YRI, YRI, YRI, YRI, YRI)

Variations - CNVs

Chr Start End Type Sources
11 5,868,055 6,007,613 CopyNumber Variation_2903 (DGV)
11 5,730,377 5,970,717 CopyNumber Variation_3836 (DGV)
11 5,885,711 5,969,185 CopyNumber Variation_8676 (DGV)
11 5,885,711 5,934,044 CopyNumber Variation_8677 (DGV)
11 5,883,376 5,935,626 CopyNumber Variation_30541 (DGV)
11 5,505,764 6,194,475 CopyNumber Variation_34458 (DGV)
11 5,885,709 5,935,510 CopyNumber Variation_37668 (DGV)
11 5,875,867 5,935,103 CopyNumber Variation_48859 (DGV)
11 5,871,831 5,935,103 CopyNumber Variation_53856 (DGV)
11 5,895,090 5,898,118 Deletion, CopyNumber #255 (Waszak)

Haplotypes

Protein haplotypes were calculated using the 1000 genomes project as described in Olender T. et. al. BMC Genomics 2012.