Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

OR52E8 Olfactory Receptor

Gene Symbol OR52E81 (View this gene in GeneCards)
Family 52
Subfamily E
Pseudogene No
CORP pseudogene probability score 0 (functional)
Aliases OR11-54, HsOR11.3.85, ORL3334
External Ids HGNC: 15217   GeneBank: BK004301, NM_001005168   ORDB: ORL3334   
Build #39 labels OR52E8
Chromosomal location 11:5,856,752-5,857,690 (-)
Cluster 11@6
Synteny CLIC#23
Remarks

Most Similar ORs in Humans (Paralogs)

Symbol Percent Length
OR52E6 89.14% 313

Most Similar ORs in other species (Orthologs)

Specie Symbol Percent Length
Dog OR52E8 90% 312
Dog OR52E8C 89% 312
Dog OR52E8D 87% 311
Chimp CONTIG*********** 99% 313
Mouse Or52e8b 84% 313
Mouse Or52e8 85% 313
Rat Or52e8b 85% 313
Rat Or52e8 84% 312
Cow OR52E8 85% 308

Expression evidences

Source Accession
ESTs EG357710
mRNA BC137041
GNF Atlas2 gnf1h01945_at
GNF Atlas2 gnf1h10875_s_at

Sequence information

Nucleotide sequence ATGTCTACGTCTAATCACACCCAGTTCCATCCTTCTTCATTCCTACTGCTGGGTATCCCA
GGGCTAGAAGATGTGCACATTTGGATTGGAGTCCCTTTTTTCTTTGTGTATCTTGTTGCA
CTCCTGGGAAACACTGCTCTCTTGTTTGTGATCCAGACTGAGCAGAGTCTCCATGAGCCT
ATGTACTACTTCCTGGCCATGTTGGATTCCATTGACCTGGGCTTGTCTACAGCCACCATC
CCCAAAATGTTGGGCATCTTCTGGTTCAATACCAAAGAAATATCTTTTGGAGGCTGCCTT
TCTCACATGTTCTTCATCCATTTCTTCACTGCTATGGAGAGCATTGTGTTGGTGGCCATG
GCCTTTGACCGCTACATTGCCATTTGCAAACCTCTTCGGTACACCATGATCCTCACCAGC
AAAATCATCAGCCTCATTGCAGGCATTGCTGTCCTGAGGAGCCTGTACATGGTTGTTCCA
CTGGTGTTTCTCCTTCTGAGGCTGCCCTTCTGTGGGCATCGTATCATCCCTCATACTTAT
TGTGAGCACATGGGCATTGCCCGTCTGGCCTGTGCCAGCATCAAAGTCAACATTAGGTTT
GGCCTTGGCAACATATCTCTCTTGTTACTGGATGTTATCCTTATTATTCTCTCCTATGTC
AGGATCCTGTATGCTGTCTTCTGCCTGCCCTCCTGGGAAGCTCGACTCAAAGCTCTCAAC
ACCTGTGGTTCTCATATTGGTGTTATCTTAGCCTTTTTTACACCAGCATTTTTTTCATTC
TTGACACATCGTTTTGGCCATAATATCCCACAGTATATACATATTATATTAGCCAACCTG
TATGTGGTTGTCCCACCAGCCCTCAATCCTGTAATCTATGGAGTCAGGACAAAGCAGATT
CGAGAGAGAGTGCTGAGGATTTTTCTCAAGACCAATCAC
Conceptual translation MSTSNHTQFHPSSFLLLGIPGLEDVHIWIGVPFFFVYLVALLGNTALLFVIQTEQSLHEP
MYYFLAMLDSIDLGLSTATIPKMLGIFWFNTKEISFGGCLSHMFFIHFFTAMESIVLVAM
AFDRYIAICKPLRYTMILTSKIISLIAGIAVLRSLYMVVPLVFLLLRLPFCGHRIIPHTY
CEHMGIARLACASIKVNIRFGLGNISLLLLDVILIILSYVRILYAVFCLPSWEARLKALN
TCGSHIGVILAFFTPAFFSFLTHRFGHNIPQYIHIILANLYVVVPPALNPVIYGVRTKQI
RERVLRIFLKTNH

Protein domains and features

Variations - SNPs

Chr Start End Type Variation AA Change SNP IDs
11 5,878,187 5,878,187 Del(1) -/T rs71640255 (DbSNP)
11 5,878,370 5,878,369 Ins(1) -/C rs35272168 (DbSNP)
11 5,878,059 5,878,059 NS A/G F/L rs61059077 (DbSNP)
11 5,857,606 5,857,606 NS T/A I/F 1000GP (CEU)
11 5,857,387 5,857,387 NS G/A H/Y 1000GP (CEU)
11 5,856,938 5,856,938 SYN G/T A/A 1000GP (CHBJPT)
11 100 -100 NS C/T R/Q 1000GP (YRI, YRI)
11 100 -100 SYN C/T L/L 1000GP (YRI)

Variations - CNVs

Chr Start End Type Sources
11 5,868,055 6,007,613 CopyNumber Variation_2903 (DGV)
11 5,730,377 5,970,717 CopyNumber Variation_3836 (DGV)
11 5,871,630 5,883,376 CopyNumber Variation_31805 (DGV)
11 5,505,764 6,194,475 CopyNumber Variation_34458 (DGV)
11 5,873,442 5,888,004 CopyNumber Variation_34990 (DGV)
11 5,874,403 5,883,432 CopyNumber Variation_37480 (DGV)
11 5,872,237 5,883,317 CopyNumber Variation_38003 (DGV)
11 5,873,985 5,883,493 CopyNumber Variation_41251 (DGV)
11 5,875,867 5,935,103 CopyNumber Variation_48859 (DGV)
11 5,871,831 5,935,103 CopyNumber Variation_53856 (DGV)
11 5,874,145 5,883,464 CopyNumber Variation_65853 (DGV)
11 5,873,318 5,883,937 CopyNumber Variation_75533 (DGV)
11 5,876,188 5,881,370 CopyNumber Variation_75534 (DGV)
11 5,869,874 5,883,937 CopyNumber Variation_75535 (DGV), Variation_85632 (DGV)
11 5,874,466 5,881,370 CopyNumber Variation_75536 (DGV)
11 5,873,605 5,883,937 CopyNumber Variation_85633 (DGV)
11 5,875,614 5,881,928 CopyNumber Variation_85634 (DGV)
11 5,877,336 5,881,370 CopyNumber Variation_85635 (DGV)
Deletion 248 (Hasin)
11 5,875,982 5,879,020 Deletion #19 (Waszak)

Haplotypes

Protein haplotypes were calculated using the 1000 genomes project as described in Olender T. et. al. BMC Genomics 2012.

L292F E186K H177P R137Q F108L H106Y G102D N94D I33F % Freq CORP
1 L E H R F H G N I 93.63 0.009
2 L E H R F H G N F 1.77 0.009
3 F E H R F H G N I 1.15 0.009
4 L E H R F H G D I 1.00 0.009
5 L E P R F H G N I 0.92 0.009
6 L E H Q F H G N I 0.84 0.009
7 L E H R F H D N I 0.38 0.009
8 L E H R F Y G N F 0.15 0.009
9 L K H R F H G N I 0.08 0.009
10 L E H R L H G N I 0.08 0.009

AceView Gene Models

The information is based on AceView gene models, constructed from cDNA sequences. The information might be incomplete.

Accession Type Chr Start End Strand
OR52E8.aApr07-unspliced main_exon 3UTR chr11 5,856,749 5,856,752 -
CDS chr11 5,856,752 5,857,690 -
5UTR chr11 5,857,690 5,857,702 -