Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

OR52H1 Olfactory Receptor

Gene Symbol OR52H11 (View this gene in GeneCards)
Family 52
Subfamily H
Pseudogene No
CORP pseudogene probability score
Aliases OR11-41, OR11-45, HsOR11.3.70, ORL3342
External Ids HGNC: 15218   GeneBank: AB065802, BK004383, BK004682, NM_001005289   ORDB: ORL3342   
Build #39 labels OR52H1
Chromosomal location 11:5,544,564-5,545,505 (-)
Cluster 11@5
Synteny CLIC#23
Remarks Segregating Pseudo Gene, a nonsynonymous SNP in a highly conserved amino-acid (rs1566275)

Most Similar ORs in Humans (Paralogs)

Symbol Percent Length
OR52H2P 76.85% 311

Most Similar ORs in other species (Orthologs)

Specie Symbol Percent Length
Dog OR52H1 88% 314
Dog OR52H1B 89% 314
Chimp CONTIG465.60-11302 95% 314
Mouse Or52h1 90% 310
Rat Or52h1 89% 310
Cow OR52H1 89% 310
Cow OR52H1D 89% 314

Expression evidences

Source Accession
mRNA BC136998
GNF Atlas2 gnf1h05810_at

Sequence information

Nucleotide sequence ATGATCATTTTCAACCTGAGCAGTTACAATCCAGGACCCTTCATTCTGGTAGGGATCCCA
GGCCTGGAGCAATTCCATGTGTGGATTGGAATTCCCTTCTGTATCATCTACATTGTAGCT
GTTGTGGGAAACTGCATCCTTCTCTACCTCATTGTGGTGGAGCATAGTCTTCATGAACCC
ATGTTCTTCTTTCTCTCCATGCTGGCCATGACTGACCTCATCTTGTCCACAGCTGGTGTG
CCTAAAGCACTCAGTATCTTTTGGCTAGGGGCTCGCGAAATCACATTCCCAGGATGCCTT
ACACAAATGTTCTTCCTTCACTATAACTTTGTCCTGGATTCAGCCATTCTGATGGCCATG
GCATTTGATCACTATGTAGCTATCTGTTCTCCCTTGAGATATACCACCATCTTGACTCCC
AAGACCATCATCAAGAGTGCTATGGGCATCTCCTTTCGAAGCTTCTGCATCATCCTGCCA
GATGTATTCTTGCTGACATGCCTGCCTTTCTGCAGGACACGCATCATACCCCACACATAC
TGTGAGCATATAGGTGTTGCCCAGCTCGCCTGTGCTGATATCTCCATCAACTTCTGGTAT
GGCTTTTGTGTTCCCATCATGACGGTCATCTCAGATGTGATTCTCATTGCTGTTTCCTAC
GCACACATCCTCTGTGCTGTCTTTGGCCTTCCCTCCCAAGATGCCTGCCAGAAAGCCCTC
GGCACTTGTGGTTCTCATGTCTGTGTCATCCTCATGTTTTATACACCTGCCTTTTTCTCC
ATCCTCGCCCATCGCTTTGGACACAATGTCTCTCGCACCTTCCACATCATGTTTGCCAAT
CTCTACATTGTTATCCCACCTGCACTCAACCCCATGGTTTACGGAGTGAAGACCAAGCAG
ATCAGAGATAAGGTTATACTTTTGTTTTCTAAGGGTACAGGA
Conceptual translation MIIFNLSSYNPGPFILVGIPGLEQFHVWIGIPFCIIYIVAVVGNCILLYLIVVEHSLHEP
MFFFLSMLAMTDLILSTAGVPKALSIFWLGAREITFPGCLTQMFFLHYNFVLDSAILMAM
AFDHYVAICSPLRYTTILTPKTIIKSAMGISFRSFCIILPDVFLLTCLPFCRTRIIPHTY
CEHIGVAQLACADISINFWYGFCVPIMTVISDVILIAVSYAHILCAVFGLPSQDACQKAL
GTCGSHVCVILMFYTPAFFSILAHRFGHNVSRTFHIMFANLYIVIPPALNPMVYGVKTKQ
IRDKVILLFSKGTG

Protein domains and features

Variations - SNPs

Chr Start End Type Variation AA Change SNP IDs
11 100 -100 NS A/G M/T 1000GP (YRI, YRI, YRI, YRI, YRI, YRI, YRI, YRI, YRI)
11 100 -100 SYN C/T T/T 1000GP (YRI, YRI)
11 5,544,676 5,544,676 NS A/G M/T 1000GP (CEU, CHBJPT)
11 5,544,800 5,544,800 NS A/G C/R 1000GP (CEU, CHBJPT)
11 5,544,821 5,544,821 NS C/A G/C 1000GP (CEU, CHBJPT)
11 5,544,882 5,544,882 SYN C/T T/T 1000GP (CEU, CHBJPT)
11 5,545,135 5,545,135 NS T/C H/R 1000GP (CEU, CHBJPT)
11 5,545,259 5,545,259 NS C/T A/T 1000GP (CEU, CHBJPT)
11 5,565,906 5,565,906 NS A/G M/T rs7934354 (DbSNP)
11 5,566,030 5,566,030 NS G/A R/C rs1995158 (DbSNP)
11 5,566,051 5,566,051 NS C/A G/C rs1995157 (DbSNP)
11 5,566,112 5,566,112 SYN T/C T/T rs1995156 (DbSNP)
11 5,566,227 5,566,226 Ins(1) -/A rs35658346 (DbSNP)
11 5,566,365 5,566,365 NS T/C H/R rs1566275 (DbSNP)
11 5,566,489 5,566,489 NS C/T A/T rs10769054 (DbSNP)
11 5,566,615 5,566,615 NS C/T V/I rs2254076 (DbSNP)
11 5,566,620 5,566,620 NS A/G V/A rs56291963 (DbSNP)

Variations - CNVs

Chr Start End Type Sources
11 5,505,764 6,194,475 CopyNumber Variation_34458 (DGV)
11 5,563,794 5,566,835 Deletion, CopyNumber #258 (Waszak)

Haplotypes

Protein haplotypes were calculated using the 1000 genomes project as described in Olender T. et. al. BMC Genomics 2012.

M283T R278H G235C A227V I182V H130R I122V C105F A89T V47I V45A % Freq CORP
1 M R C A I R I C T V V 37.25 0.614
2 M R G A I R I C A V V 30.49 0.663
3 T R G A I R I C A V V 14.82 0.663
4 M R G A I H I C A V V 11.90 0.663
5 M R C A I R I C T V A 1.84 0.614
6 M R G A I R I F A V V 1.54 0.663
7 M R G A I R I C T V V 0.46 0.663
8 M R C A V R I C T V V 0.38 0.614
9 M R G A I H I C A I V 0.38 0.663
10 M R G A I H V C A I V 0.31 0.663
11 M R C V I R I C T V V 0.15 0.321
12 M H G A I R I C A V V 0.15 0.663
13 T R G A I H I C A V V 0.15 0.663
14 M R C A I R I C A V V 0.08 0.614
15 M R C A I H I C T V V 0.08 0.614

AceView Gene Models

The information is based on AceView gene models, constructed from cDNA sequences. The information might be incomplete.

Accession Type Chr Start End Strand
OR52H1.aApr07-unspliced main_exon 3UTR chr11 5,544,561 5,544,564 -
CDS chr11 5,544,564 5,545,505 -
5UTR chr11 5,545,505 5,545,523 -