Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

OR52H2P Olfactory Receptor

Gene Symbol OR52H2P1 (View this gene in GeneCards)
Family 52
Subfamily H
Pseudogene Yes
CORP pseudogene probability score
Aliases HsOR11.3.71P, ORL3614
External Ids HGNC: 15219   GeneBank: NG_004222   ORDB: ORL3614   
Build #39 labels OR52H2P
Chromosomal location 11:5,551,665-5,552,596 (-)
Cluster 11@5
Synteny CLIC#23
Remarks

Most Similar ORs in Humans (Paralogs)

Symbol Percent Length
OR52H1 76.85% 311

Most Similar ORs in other species (Orthologs)

Specie Symbol Percent Length
Dog OR52H2 84% 310
Dog OR52H1C 81% 313
Chimp CONTIG*********** 95% 311
Mouse Or52h2 87% 310
Rat Or52h2 85% 310
Cow OR52H2 85% 306

Sequence information

Nucleotide sequence ATGTACAACATGAGTGACCATGGTACAGGCCTGTTCATCCTTTTGGGTATCCCTGGACTT
GAGCAGTACCACGTCTGGATCAGCATCCCATTCTGCTTAATCTATCTCATGGCTGTCGTG
GCCAATAGTATCCTTCTCTACCTCATTGTGGTAGAGCACAGTCTTCATGCACCCATGTTC
TTTTTCCTTTCCATGCTGGCCATTACTGATCTCATATTGTCCACCACATGTGTCCCCAAA
ACACTTAGCATCTTCTGGTTTGGTCCCCAAACAGTTTCCCTGGCTGTCTCACCCAATTAT
TCTTTCTGCACTATAGCTTTGTGTTGGACTCAGCTATACTGCTGGCCATGGCATTTGACC
GCTATATGGCCATTTGCTCACCCTTGAGATACACTACTATTCTGACTCCCAAAACCATTG
TCAAAATTGCTGTGGGAATATGTTTCCGAAGTTTCTGTGTTTTTGTCCCATGTGTTTTCC
TTGTGAATCGTTTACCCTTCTGCAGGACACATATCATTTCTCACACATACTGTGAGCACA
TAGGTGTTGCCCAGCTTGCCTGTGCTGATATCTCCATCAATATCTGGTGTGGATTTTGTG
TTCCCATCATGACGGTGATGACAGACGTGATCCTCATTGCTGTCTCCTACACCCTCATCC
TCTGTGCTGTCTTTTGCCTCCCCTCCCAAGATGCCCGTCAGAAGGCCCTTTGCTCCTGTG
GTTCCCATGTCTGTGTTATCCTCATATTCTATATACCAGCATTCTTCTCCATTCTTGCCC
ATTGCTTTGGGCATAATGTCCCTCATACCTTTCATATTATGTTTGCCAACCTTTATGTAA
TCATTCCACCTGCTCTCAACTCTATTGTCTACAGAATAAAGACCAAGCAAATCCAGAACA
GAATCCTTTTGCTCTTTCCCAAGGGGTCCCAG
Conceptual translation MYNMSDHGTGLFILLGIPGLEQYHVWISIPFCLIYLMAVVANSILLYLIVVEHSLHAPMF
FFLSMLAITDLILSTTCVPKTLSIFWFGPQ/SFPGCLTQLFFLHYSFVLDSAILLAMAF
DRYMAICSPLRYTTILTPKTIVKIAVGICFRSFCVFVPCVFLVNRLPFCRTHIISHTYCE
HIGVAQLACADISINIWCGFCVPIMTVMTDVILIAVSYTLILCAVFCLPSQDARQKALCS
CGSHVCVILIFYIPAFFSILAHCFGHNVPHTFHIMFANLYVIIPPALNSIVYRIKTKQIQ
NRILLLFPKGSQ

Protein domains and features

Variations - SNPs

Chr Start End Type Variation AA Change SNP IDs
11 100 -100 SNP A/G 1000GP (YRI, YRI, YRI, YRI, YRI, YRI, YRI, YRI, YRI, YRI, YRI, YRI, YRI, YRI, YRI, YRI)
11 5,551,736 5,551,736 SNP A/G 1000GP (CEU, CHBJPT)
11 5,551,772 5,551,772 SNP C/A 1000GP (CEU)
11 5,551,794 5,551,794 SNP A/G 1000GP (CEU, CHBJPT)
11 5,551,814 5,551,814 SNP A/G 1000GP (CEU, CHBJPT)
11 5,551,824 5,551,824 SNP A/G 1000GP (CEU, CHBJPT)
11 5,551,843 5,551,843 SNP A/G 1000GP (CEU, CHBJPT)
11 5,551,903 5,551,903 SNP G/T 1000GP (CEU)
11 5,551,930 5,551,930 SNP G/C 1000GP (CEU, CHBJPT)
11 5,551,963 5,551,963 SNP A/T 1000GP (CHBJPT)
11 5,552,085 5,552,085 SNP A/G 1000GP (CEU, CHBJPT)
11 5,552,120 5,552,120 SNP A/C 1000GP (CEU, CHBJPT)
11 5,552,127 5,552,127 SNP T/C 1000GP (CEU, CHBJPT)
11 5,552,350 5,552,350 SNP T/G 1000GP (CEU, CHBJPT)
11 5,552,471 5,552,471 SNP A/C 1000GP (CEU, CHBJPT)
11 5,572,966 5,572,966 SNP G/A rs423501 (DbSNP)
11 5,573,002 5,573,002 SNP A/C rs55690955 (DbSNP)
11 5,573,024 5,573,024 SNP A/G rs60009475 (DbSNP)
11 5,573,044 5,573,044 SNP A/G rs9666981 (DbSNP)
11 5,573,054 5,573,054 SNP A/G rs9666982 (DbSNP)
11 5,573,073 5,573,073 SNP G/A rs1694674 (DbSNP)
11 5,573,133 5,573,133 SNP G/T rs62623383 (DbSNP)
11 5,573,160 5,573,160 SNP C/G rs401835 (DbSNP)
11 5,573,168 5,573,168 SNP C/G rs383475 (DbSNP)
11 5,573,193 5,573,193 SNP A/T rs11038071 (DbSNP)
11 5,573,221 5,573,221 SNP G/T rs9667237 (DbSNP)
11 5,573,315 5,573,315 SNP G/A rs382979 (DbSNP)
11 5,573,350 5,573,350 SNP A/C rs62623418 (DbSNP)
11 5,573,357 5,573,357 SNP T/C rs408409 (DbSNP)
11 5,573,580 5,573,580 SNP G/T rs10500651 (DbSNP)
11 5,573,701 5,573,701 SNP A/C rs2647602 (DbSNP)
11 5,573,710 5,573,710 SNP G/A rs2570348 (DbSNP)

Variations - CNVs

Chr Start End Type Sources
11 5,505,764 6,194,475 CopyNumber Variation_34458 (DGV)
11 5,570,895 5,573,926 CopyNumber #62 (Waszak)

Haplotypes

Protein haplotypes were calculated using the 1000 genomes project as described in Olender T. et. al. BMC Genomics 2012.