Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

OR52I1 Olfactory Receptor

Gene Symbol OR52I11 (View this gene in GeneCards)
Family 52
Subfamily I
Pseudogene No
CORP pseudogene probability score 0.34 (functional)
Aliases OR11-13, HsOR11.3.12, ORL3428
External Ids HGNC: 15220   GeneBank: AB065788, BK004371, NM_001005169   ORDB: ORL3428   
Build #39 labels OR52I1
Chromosomal location 11:4,594,066-4,595,010 (+)
Cluster 11@5
Synteny CLIC#23
Remarks

Most Similar ORs in Humans (Paralogs)

Symbol Percent Length
OR52I2 95.06% 324

Most Similar ORs in other species (Orthologs)

Specie Symbol Percent Length
Dog OR52E22 48% 305
Mouse Or52i2 78% 324
Rat Or52b2 47% 312
Cow OR52I1B 81% 324
Orang OR52I2 92% 324
Orang OR52I1C 91% 324
Horse OR52I2 81% 324
Chimp OR52I1B 95% 324

Expression evidences

Source Accession
mRNA AB463977
GNF Atlas2 gnf1h10649_at

Sequence information

Nucleotide sequence ATGGAAACCCCTGCCTCCTTCCTCCTTGTGGGTATCCCAGGACTGCAATCTTCACATCTT
TGGCTGGCTATCTCACTGAGTGCCATGTACATCACAGCCCTGTTAGGAAACACCCTCATC
GTGACTGCAATCTGGATGGATTCCACTCGGCATGAGCCCATGTATTGCTTTCTGTGTGTT
CTGGCTGCTGTGGACATTGTTATGGCCTCCTCCGTGGTACCCAAGATGGTGAGCATCTTC
TGCTCGGGAGACAGCTCCATCAGCTTTAGTGCTTGTTTCACTCAGATGTTTTTTGTCCAC
TTAGCCACAGCTGTGGAGACGGGGCTGCTGCTGACCATGGCTTTTGACCGCTATGTAGCC
ATCTGCAAGCCTCTACACTACAAGAGAATTCTCACGCCTCAAGTGATGCTGGGAATGAGT
ATGGCCGTCACCATCAGAGCTGTCACATTCATGACTCCACTGAGTTGGATGATGAATCAT
CTACCTTTCTGTGGCTCCAATGTGGTTGTCCACTCCTACTGTAAGCACATAGCTTTGGCC
AGGTTAGCATGTGCTGACCCCGTGCCCAGCAGTCTCTACAGTCTGATTGGTTCCTCTCTT
ATGGTGGGCTCTGATGTGGCCTTCATTGCTGCCTCCTATATCTTAATTCTCAGGGCAGTA
TTTGATCTCTCCTCAAAGACTGCTCAGTTGAAAGCATTAAGCACATGTGGCTCCCATGTG
GGGGTTATGGCTTTGTACTATCTACCTGGGATGGCATCCATCTATGCGGCCTGGTTGGGG
CAGGATATAGTGCCCTTGCACACCCAAGTGCTGCTAGCTGACCTGTACGTGATCATCCCA
GCCACTTTAAATCCCATCATCTATGGCATGAGGACCAAACAATTGCTGGAGGGAATATGG
AGTTATCTGATGCACTTCCTCTTTGACCACTCCAACCTGGGTTCA
Conceptual translation MLGPAYNHTMETPASFLLVGIPGLQSSHLWLAISLSAMYITALLGNTLIVTAIWMDSTRH
EPMYCFLCVLAAVDIVMASSVVPKMVSIFCSGDSSISFSACFTQMFFVHLATAVETGLLL
TMAFDRYVAICKPLHYKRILTPQVMLGMSMAVTIRAVTFMTPLSWMMNHLPFCGSNVVVH
SYCKHIALARLACADPVPSSLYSLIGSSLMVGSDVAFIAASYILILRAVFDLSSKTAQLK
ALSTCGSHVGVMALYYLPGMASIYAAWLGQDIVPLHTQVLLADLYVIIPATLNPIIYGMR
TKQLLEGIWSYLMHFLFDHSNLGS

Protein domains and features

Variations - SNPs

Chr Start End Type Variation AA Change SNP IDs
11 100 -100 NS C/T T/I 1000GP (YRI, YRI)
11 100 -100 SYN C/G S/S 1000GP (YRI)
11 4,594,889 4,594,889 NS T/C L/P 1000GP (CEU)
11 4,615,390 4,615,390 NS C/T T/I rs2010722 (DbSNP)
11 4,615,423 4,615,423 NS C/T A/V rs61745326 (DbSNP)
11 4,615,508 4,615,508 SYN C/G S/S rs2010719 (DbSNP)
11 4,615,616 4,615,616 SYN A/G T/T rs56095500 (DbSNP)
11 4,615,857 4,615,857 NS A/G M/V rs62622512 (DbSNP)
11 4,615,987 4,615,987 NS A/C K/T rs1876025 (DbSNP)
11 4,616,062 4,616,062 NS C/T A/V rs61997187 (DbSNP)
11 4,616,119 4,616,119 NS C/T P/L rs61997192 (DbSNP)

Haplotypes

Protein haplotypes were calculated using the 1000 genomes project as described in Olender T. et. al. BMC Genomics 2012.

T66I A77V M192V N193S C208R K209E K265T A290V L309P N346S % Freq CORP
1 I A M N C K K A L N 78.96 0.748
2 T A M N C K K A L N 11.06 0.748
3 I A M N C K K V L N 3.76 0.748
4 I A M N C K K V P N 2.92 0.748
5 T A V S C K K A L N 0.92 0.748
6 I A M N C K T A L N 0.92 0.748
7 I V M N C K K V L N 0.38 0.748
8 T A V S C E K A L N 0.23 0.748
9 I A M N C K K A P N 0.15 0.748
10 T A M N C K K A L S 0.15 0.748
11 T A M N C K K V L N 0.15 0.748
12 I A M N C E K A L N 0.08 0.748
13 T A V N C E K A L N 0.08 0.748
14 I A M N R K K A L N 0.08 0.748
15 T A V S C K K A L S 0.08 0.748
16 T A V N C K K A L N 0.08 0.748

AceView Gene Models

The information is based on AceView gene models, constructed from cDNA sequences. The information might be incomplete.

Accession Type Chr Start End Strand
OR52I1.aApr07-unspliced main_exon 5UTR chr11 4,594,039 4,594,066 +
CDS chr11 4,594,066 4,595,010 +
3UTR chr11 4,595,010 4,595,013 +