Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

OR52I2 Olfactory Receptor

Gene Symbol OR52I21 (View this gene in GeneCards)
Family 52
Subfamily I
Pseudogene No
CORP pseudogene probability score 0.34 (functional)
Aliases OR11-12, HsOR11.3.11, ORL3429
External Ids HGNC: 15221   GeneBank: AB065522, BK004264, NM_001005170   ORDB: ORL3429   
Build #39 labels OR52I2
Chromosomal location 11:4,586,918-4,587,862 (+)
Cluster 11@5
Synteny CLIC#23
Remarks

Most Similar ORs in Humans (Paralogs)

Symbol Percent Length
OR52I1 95.06% 324

Most Similar ORs in other species (Orthologs)

Specie Symbol Percent Length
Dog OR52I1 83% 324
Mouse Or52i2 80% 324
Rat Or52e5b 48% 303
Cow OR52I1B 82% 324
Cow OR52I1 81% 324
Cow OR52I11 81% 324
Orang OR52I1 95% 324
Horse OR52I1 82% 324
Horse OR52I12 81% 324
Horse OR52I13 81% 315
Chimp OR52I1B 97% 324
Chimp OR52I1 96% 324

Expression evidences

Source Accession
mRNA BC151144

Sequence information

Nucleotide sequence ATGGAAACCCCTGCCTCCTTCCTCCTTGTGGGTATCCCAGGACTGCAATCTTCACATCTT
TGGCTGGCTATCTCACTGAGTGCCATGTACATCATAGCCCTGTTAGGAAACACCATCATC
GTGACTGCAATCTGGATGGATTCCACTCGGCATGAGCCCATGTATTGCTTTCTGTGTGTT
CTGGCTGCTGTGGACATTGTTATGGCCTCCTCGGTGGTACCCAAGATGGTGAGCATCTTC
TGCTCAGGAGACAGCTCAATCAGCTTTAGTGCTTGTTTCACTCAGATGTTTTTTGTCCAC
TTAGCCACAGCTGTGGAGACGGGGCTGCTGCTGACCATGGCTTTTGACCGCTATGTAGCC
ATCTGCAAGCCTCTACACTACAAGAGAATTCTCACGCCTCAAGTGATGCTGGGAATGAGT
ATGGCCATCACCATCAGAGCTATCATAGCCATAACTCCACTGAGTTGGATGGTGAGTCAT
CTACCTTTCTGTGGCTCCAATGTGGTTGTCCACTCCTACTGTGAGCACATAGCTTTGGCC
AGGTTAGCATGTGCTGACCCCGTGCCCAGCAGTCTCTACAGTCTGATTGGTTCCTCTCTT
ATGGTGGGCTCTGATGTGGCCTTCATTGCTGCCTCCTATATCTTAATTCTCAAGGCAGTA
TTTGGTCTCTCCTCAAAGACTGCTCAGTTGAAAGCATTAAGCACATGTGGCTCCCATGTG
GGGGTTATGGCTTTGTACTATCTACCTGGGATGGCATCCATCTATGCGGCCTGGTTGGGG
CAGGATGTAGTGCCCTTGCACACCCAAGTCCTGCTAGCTGACCTGTACGTGATCATCCCA
GCCACCTTAAATCCCATCATCTATGGCATGAGGACCAAACAACTGCGGGAGAGAATATGG
AGTTATCTGATGCATGTCCTCTTTGACCATTCCAACCTGGGTTCA
Conceptual translation MLGPAYNHTMETPASFLLVGIPGLQSSHLWLAISLSAMYIIALLGNTIIVTAIWMDSTRH
EPMYCFLCVLAAVDIVMASSVVPKMVSIFCSGDSSISFSACFTQMFFVHLATAVETGLLL
TMAFDRYVAICKPLHYKRILTPQVMLGMSMAITIRAIIAITPLSWMVSHLPFCGSNVVVH
SYCEHIALARLACADPVPSSLYSLIGSSLMVGSDVAFIAASYILILKAVFGLSSKTAQLK
ALSTCGSHVGVMALYYLPGMASIYAAWLGQDVVPLHTQVLLADLYVIIPATLNPIIYGMR
TKQLRERIWSYLMHVLFDHSNLGS

Protein domains and features

Variations - SNPs

Chr Start End Type Variation AA Change SNP IDs
11 100 -100 NS T/C I/T 1000GP (YRI, YRI)
11 4,587,012 4,587,012 NS T/C I/T 1000GP (CEU)
11 4,587,032 4,587,032 NS A/C I/L 1000GP (CEU)
11 4,608,242 4,608,242 NS C/T T/I rs61744242 (DbSNP)
11 4,608,262 4,608,262 NS A/C I/L rs12793957 (DbSNP)
11 4,608,393 4,608,393 SYN A/G S/S rs56002758 (DbSNP)
11 4,608,405 4,608,405 SYN C/A S/S rs2201338 (DbSNP)
11 4,608,542 4,608,542 NS T/C M/T rs1847632 (DbSNP)
11 4,608,574 4,608,574 NS A/G I/V rs7947426 (DbSNP)
11 4,608,589 4,608,589 NS A/G I/V rs7947432 (DbSNP)
11 4,608,726 4,608,726 SYN C/T Y/Y rs55804480 (DbSNP)

Haplotypes

Protein haplotypes were calculated using the 1000 genomes project as described in Olender T. et. al. BMC Genomics 2012.

I67T I74L D119G T167M % Freq CORP
1 I I D T 45.55 0.768
2 I I D M 37.17 0.768
3 I L D T 13.44 0.768
4 T I D T 3.38 0.768
5 I L D M 0.23 0.768
6 T L D T 0.15 0.768
7 I I G T 0.08 0.768

AceView Gene Models

The information is based on AceView gene models, constructed from cDNA sequences. The information might be incomplete.

Accession Type Chr Start End Strand
OR52I2.aApr07-unspliced main_exon 5UTR chr11 4,586,813 4,586,918 +
CDS chr11 4,586,918 4,587,862 +
3UTR chr11 4,587,862 4,587,865 +