Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

OR52J1P Olfactory Receptor

Gene Symbol OR52J1P1 (View this gene in GeneCards)
Family 52
Subfamily J
Pseudogene Yes
CORP pseudogene probability score
Aliases HsOR11.3.48P, ORL3487
External Ids HGNC: 14760   GeneBank: NG_002234   ORDB: ORL3487   
Build #39 labels OR52J1P
Chromosomal location 11:5,104,153-5,105,081 (+)
Cluster 11@5
Synteny CLIC#23
Remarks

Most Similar ORs in Humans (Paralogs)

Symbol Percent Length
OR52J2P 68.06% 310
OR52J3 71.38% 311

Most Similar ORs in other species (Orthologs)

Specie Symbol Percent Length
Dog OR52J1 87% 311
Chimp CONTIG465.101-7077 95% 309
Mouse Or52j3 71% 309
Rat Or52j3 70% 309
Cow OR52J1 83% 311

Sequence information

Nucleotide sequence ATGTTCCACACCACCACCACCATTTTCCACCCAGACACCTTTTTTCTGACAGGCATCCCG
GGACTTGAGGCTTTCCATGGCTGGATTTCCATGCCCTTTTGCTGTATTTACTTGATGCCT
CTGCTGGGCAATGCTACAATTCTACTGACAATCTGGTCTGATCGTACTCTTCGGGACCCT
ATGTTCTACTTTCTAGCCATCTTATCAGCCATAGACCTAGCCCTCTCAACATCCTCAGTG
CCTCGTATGTTGGGTATCTTCTGGTTTGATGCACATAAAATTGGCTTTGGAGCCTGGGTA
GCCCAGATGTTTCTGATACACACTTTCACAGGAATGGAGTCCACTGTGCTGCTGGCAATG
GCCTTTGACCGCTATGTGGCCATCTGTACATCACTCCACTATACCTCTACTCTGACACCC
CGAGTATTGGCAGGCATTGGTGTGAGCATTATAATGCGCCCAGTCCTGCTCATGTTGCCC
ATTCTCTACCTAACCCATCGTCTGCCCTTCTGTGAGGCTCGGATTATTGCCCACTCCTAC
TGTGAGCACATGGGTATTGCTAAGTTGGCCTGTGCTAGCATTCACATCAATGCTATTTAT
GGGCTTTTTGTGGCTTCTTATTTTGGATGTCGCACTTGTTGGAATCTCCTATACCTACAT
TCTCCGAGCTGTTTTCCACCTCCCATCTCAAGACGCTCGTCACAAAGCACTGAGAACGTG
TGGCTCACATGTTGGGGTCATGTGTGTTTTCTATACACCCTCCCTCTTCTCCTTCCTCAC
CTACCGATTTCGCAAAAAAAATTCCCCGTTATGTCCACATTCTTGTTGCCAACCTCTATG
TGGTCATTCCACCTGCCCTCAATCCTATTATCTATGGTGTGAGAACCAAGCAGATTCATG
AGCATGTGGTCCATACTTTCACCTCAAAG
Conceptual translation MFHTTTTIFHPDTFFLTGIPGLEAFHGWISMPFCCIYLMPLLGNATILLTIWSDRTLRDP
MFYFLAILSAIDLALSTSSVPRMLGIFWFDAHKIGFGAWVAQMFLIHTFTGMESTVLLAM
AFDRYVAICTSLHYTSTLTPRVLAGIGVSIIMRPVLLMLPILYLTHRLPFCEARIIAHSY
CEHMGIAKLACASIHINAIYGLFV\LILDVALVGISYTYILRAVFHLPSQDARHKALRT
CGSHVGVMCVFYTPSLFSFLTYRF\KKIPRYVHILVANLYVVIPPALNPIIYGVRTKQI
HEHVVHTFTSK

Protein domains and features

Variations - SNPs

Chr Start End Type Variation AA Change SNP IDs
11 5,126,176 5,126,176 Del(1) -/A rs71989119 (DbSNP)
11 5,126,182 5,126,182 Del(1) -/A rs72517824 (DbSNP)
11 5,126,183 5,126,183 Del(1) -/A rs11341011 (DbSNP)
11 5,125,549 5,125,549 SNP A/C rs74049490 (DbSNP)
11 5,125,396 5,125,396 SNP A/C rs7951907 (DbSNP)
11 5,126,309 5,126,309 SNP A/G rs74049491 (DbSNP)
11 5,125,443 5,125,443 SNP A/G rs2959189 (DbSNP)
11 5,126,125 5,126,125 SNP A/T rs66816267 (DbSNP)
11 5,104,166 5,104,166 SNP C/A 1000GP (CEU, CHBJPT)
11 5,104,213 5,104,213 SNP G/A 1000GP (CEU, CHBJPT)
11 5,104,404 5,104,404 SNP G/A 1000GP (CEU, CHBJPT)
11 5,104,752 5,104,752 SNP T/C 1000GP (CEU)
11 5,104,895 5,104,895 SNP T/A 1000GP (CEU)
11 5,104,990 5,104,990 SNP A/G 1000GP (CEU)
11 5,104,246 5,104,246 SNP C/T 1000GP (CHBJPT)
11 5,104,799 5,104,799 SNP T/C 1000GP (CHBJPT)
11 100 -100 SNP C/A 1000GP (YRI, YRI, YRI, YRI, YRI, YRI, YRI, YRI, YRI, YRI, YRI)

Variations - CNVs

Chr Start End Type Sources
11 4,907,893 5,135,331 CopyNumber Variation_3835 (DGV)
11 5,087,292 5,125,991 CopyNumber Variation_5421 (DGV)

Haplotypes

Protein haplotypes were calculated using the 1000 genomes project as described in Olender T. et. al. BMC Genomics 2012.