Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

OR52J2P Olfactory Receptor

Gene Symbol OR52J2P1 (View this gene in GeneCards)
Family 52
Subfamily J
Pseudogene Yes
CORP pseudogene probability score
Aliases HsOR11.3.42P, ORL3499
External Ids HGNC: 14797   ORDB: ORL3499   
Build #39 labels OR52J4P, OR52J2P
Chromosomal location 11:5,037,013-5,037,948 (+)
Cluster 11@5
Synteny CLIC#23
Remarks

Most Similar ORs in Humans (Paralogs)

Symbol Percent Length
OR52J3 84.62% 312

Most Similar ORs in other species (Orthologs)

Specie Symbol Percent Length
Dog OR52J3C 87% 308
Dog OR52J3 85% 313
Chimp CONTIG465.112-455 96% 307
Mouse Or52j3 79% 312
Rat Or52j3 79% 312
Cow OR52J3DP 81% 312
Cow OR52J3 80% 312

Sequence information

Nucleotide sequence ATGGCATACCATGGCAACAGGGGCACTTCTCACCCAGCCACATTTTTTCTCATTGGAATC
CCAGGTCTGGAAGACGTCCATATGTGAATCTCCCTGCATTTCTGCTCTGTTTACCTTTTG
GCTTTGCTGGGAAATGCTACCATTCTGTTAGTCATCAAGGCAGAACAGACCCTCCGGGAG
CCCATGTTCTACTTTCTGGCCATCCTTTCCACAATTGATTTGGCCCTTTCTACAACCTCT
GTGCCTCGTACGCTGGGTATCTTCTGGTTTGATGTTCATGAGATTAACTTTGGAGCTTGT
GTGGCCCAGATGTTTCTGATCCATGCCTTCACTGGCATGGAGGCTGAGGTCCTGGTGGCC
ATGGCCTTTGACCATTACGTGGCCATCTGCAATCCACTTCACTACACAAACATCTTGACA
TGCCGGGTGCTGGTGGGCATCACTATGTGCATTTTAATTCGTCCAGTTCTGTTTACACTC
CCGATAATCTATCTCATCTACCGTTTACCATTTTGTCAGGCTCATATAATAGCCCATTCC
TACTATGAGCACATGGGCATTGCAAAATTGTCCTGTGGAAACATCCGTGTCAATGCTATC
TATGGGCTCTTTGTGGTCTCCCTCTTTCTCCTGAACCTGGTCCTTATTGTTATCTCATAT
GTTTACATTCTCTGTGCTGTCTTCTGCCTCCCATCACATGATGCTCGGCTAAAAGCCCTA
AGCACATGTGGCTCTCATGTTGGGGTCATCTGTGTTTTCTATATCCCGTCGGTCTTCTCT
TTCCTTACTCATTGATTTGGACACAACATTCCACATTACATTCACATTCTTGTTGCTACT
CTCTATTTGGTTATCCCACCCTCTCTCAACCCCATCATTTGTGGGGTGAGGACTAAATGG
AAACGAGAGCGAGTGCTCTATGTACTTACTAAAAAA
Conceptual translation MAYHGNRGTSHPATFFLIGIPGLEDVHMXSLHFCSVYLLALLGNATILLVIKAEQTLRE
PMFYFLAILSTIDLALSTTSVPRTLGIFWFDVHEINFGACVAQMFLIHAFTGMEAEVLVA
MAFDHYVAICNPLHYTNILTCRVLVGITMCILIRPVLFTLPIIYLIYRLPFCQAHIIAHS
YYEHMGIAKLSCGNIRVNAIYGLFVVSLFLLNLVLIVISYVYILCAVFCLPSHDARLKAL
STCGSHVGVICVFYIPSVFSFLTHXGHNIPHYIHILVATLYLVIPPSLNPIICGVRTKW
KRERVLYVLTKK

Protein domains and features

Variations - SNPs

Chr Start End Type Variation AA Change SNP IDs
11 5,058,951 5,058,950 Ins(1) -/G rs35624561 (DbSNP)
11 5,058,616 5,058,616 SNP A/G rs2499970 (DbSNP)
11 5,058,988 5,058,988 SNP A/T rs12420187 (DbSNP)
11 5,058,664 5,058,664 SNP C/G rs2445269 (DbSNP)
11 5,059,136 5,059,136 SNP C/T rs2445272 (DbSNP)
11 5,058,517 5,058,517 SNP C/T rs2445268 (DbSNP)
11 5,058,341 5,058,341 SNP C/T rs1463373 (DbSNP)
11 5,058,390 5,058,390 SNP C/T rs1463374 (DbSNP)
11 5,058,779 5,058,779 SNP C/T rs11035278 (DbSNP)
11 5,058,271 5,058,271 SNP C/T rs1463372 (DbSNP)
11 5,059,044 5,059,044 SNP C/T rs72860163 (DbSNP)
11 5,059,064 5,059,064 SNP G/T rs2445271 (DbSNP)
11 5,058,696 5,058,696 SNP G/T rs2445270 (DbSNP)
11 5,037,041 5,037,041 SNP C/T 1000GP (CEU, CHBJPT)
11 5,037,111 5,037,111 SNP T/C 1000GP (CEU, CHBJPT)
11 5,037,160 5,037,160 SNP T/C 1000GP (CEU, CHBJPT)
11 5,037,287 5,037,287 SNP T/C 1000GP (CEU, CHBJPT)
11 5,037,386 5,037,386 SNP A/G 1000GP (CEU, CHBJPT)
11 5,037,434 5,037,434 SNP G/C 1000GP (CEU, CHBJPT)
11 5,037,466 5,037,466 SNP T/G 1000GP (CEU, CHBJPT)
11 5,037,549 5,037,549 SNP T/C 1000GP (CEU, CHBJPT)
11 5,037,739 5,037,739 SNP T/C 1000GP (CEU)
11 5,037,758 5,037,758 SNP T/A 1000GP (CEU, CHBJPT)
11 5,037,814 5,037,814 SNP C/T 1000GP (CEU)
11 5,037,834 5,037,834 SNP T/G 1000GP (CEU, CHBJPT)
11 5,037,906 5,037,906 SNP T/C 1000GP (CEU, CHBJPT)
11 5,037,436 5,037,436 SNP C/T 1000GP (CHBJPT)
11 100 -100 SNP C/T 1000GP (YRI, YRI, YRI, YRI, YRI, YRI, YRI, YRI, YRI, YRI, YRI, YRI, YRI)

Variations - CNVs

Chr Start End Type Sources
11 4,907,893 5,135,331 CopyNumber Variation_3835 (DGV)

Haplotypes

Protein haplotypes were calculated using the 1000 genomes project as described in Olender T. et. al. BMC Genomics 2012.