Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

OR52K1 Olfactory Receptor

Gene Symbol OR52K11 (View this gene in GeneCards)
Family 52
Subfamily K
Pseudogene No
CORP pseudogene probability score 0.04 (functional)
Aliases OR11-8, HsOR11.3.8, ORL3450
External Ids HGNC: 15222   GeneBank: AB065790, BK004257, NM_001005171   ORDB: ORL3450   
Build #39 labels OR52K1
Chromosomal location 11:4,488,901-4,489,842 (+)
Cluster 11@5
Synteny CLIC#23
Remarks

Most Similar ORs in Humans (Paralogs)

Symbol Percent Length
OR52K2 90.76% 314

Most Similar ORs in other species (Orthologs)

Specie Symbol Percent Length
Dog OR52K1B 90% 313
Mouse Or52k2 88% 314
Rat Or52k1 90% 310
Rat Or52k2 87% 314
Cow OR52K2 89% 314
Orang OR52K2 90% 314
Horse OR52P2 55% 308
Chimp OR52K1P 97% 314

Expression evidences

Source Accession
mRNA BC137059
GNF Atlas2 gnf1h10682_x_at
GNF Atlas2 gnf1h10683_at

Sequence information

Nucleotide sequence ATGCTTCCCTCTAATATCACCTCAACACATCCAGCTGTCTTTTTGTTGGTAGGAATTCCT
GGTTTGGAACACCTGCATGCCTGGATCTCCATCCCCTTCTGCTTTGCTTATACTCTGGCC
CTGCTAGGCAACTGTACCCTTCTCTTCATTATCCAGGCTGATGCAGCCCTCCATGAACCC
ATGTACCTCTTTCTGGCCATGTTGGCAACCATTGACTTGGTTCTTTCTTCTACAACGCTG
CCCAAAATGCTTGCCATATTCTGGTTCAGGGATCAGGAGATCAACTTCTTTGCCTGTCTG
GTCCAGATGTTCTTCCTTCACTCCTTCTCCATCATGGAGTCAGCAGTGCTGCTGGCCATG
GCCTTTGACCGCTATGTGGCCATCTGCAAGCCATTGCACTACACGACGGTCCTGACTGGG
TCCCTCATCACCAAGATTGGCATGGCTGCTGTGGCCCGGGCTGTGACACTAATGACTCCA
CTCCCCTTCCTGCTCAGACGCTTCCACTACTGCCGAGGCCCAGTGATTGCCCATTGCTAC
TGTGAACACATGGCTGTGGTAAGGCTGGCGTGTGGGGACACTAGCTTCAACAATATCTAT
GGCATTGCTGTGGCCATGTTTATTGTGGTGTTGGACCTGCTCTTTGTTATCCTGTCTTAT
GTCTTCATCCTTCAGGCAGTTCTCCAGCTTGCCTCTCAGGAGGCCCGCTACAAGGCATTT
GGGACATGTGTGTCTCACATAGGTGCCATCCTGTCCACCTACACTCCAGTAGTCATCTCT
TCAGTCATGCACCGTGTAGCCCGCCATGCTGCCCCTCGTGTCCACATACTCCTTGCTATT
TTCTATCTCCTTTTCCCACCCATGGTCAATCCTATCATATATGGAGTCAAGACCAAGCAG
ATTCGTGAGTATGTGCTCAGTCTATTCCAGAGAAAGAACATG
Conceptual translation MLPSNITSTHPAVFLLVGIPGLEHLHAWISIPFCFAYTLALLGNCTLLFIIQADAALHEP
MYLFLAMLATIDLVLSSTTLPKMLAIFWFRDQEINFFACLVQMFFLHSFSIMESAVLLAM
AFDRYVAICKPLHYTTVLTGSLITKIGMAAVARAVTLMTPLPFLLRRFHYCRGPVIAHCY
CEHMAVVRLACGDTSFNNIYGIAVAMFIVVLDLLFVILSYVFILQAVLQLASQEARYKAF
GTCVSHIGAILSTYTPVVISSVMHRVARHAAPRVHILLAIFYLLFPPMVNPIIYGVKTKQ
IREYVLSLFQRKNM

Protein domains and features

Variations - SNPs

Chr Start End Type Variation AA Change SNP IDs
11 100 -100 NS A/G Q/R 1000GP (YRI)
11 4,489,055 4,489,055 NS A/G Q/R 1000GP (CEU, CHBJPT)
11 4,510,285 4,510,285 NS G/A R/Q rs96489 (DbSNP)
11 4,510,553 4,510,553 SYN C/T S/S rs3889581 (DbSNP)
11 4,510,587 4,510,587 NS T/C W/R rs331510 (DbSNP)

Variations - CNVs

Chr Start End Type Sources
11 4,055,945 4,510,188 CopyNumber Variation_3834 (DGV)
11 4,510,031 4,513,072 Deletion, CopyNumber #259 (Waszak)
11 4,510,137 4,562,393 CopyNumber Variation_38231 (DGV)
11 4,510,284 4,562,394 CopyNumber Variation_9172 (DGV)
11 4,510,285 4,562,458 CopyNumber Variation_2899 (DGV)

Haplotypes

Protein haplotypes were calculated using the 1000 genomes project as described in Olender T. et. al. BMC Genomics 2012.

L25P Q52R I71T % Freq CORP
1 L Q I 63.13 0.052
2 L R I 35.87 0.052
3 P R I 0.46 0.052
4 L R T 0.46 0.052
5 P Q I 0.08 0.052

AceView Gene Models

The information is based on AceView gene models, constructed from cDNA sequences. The information might be incomplete.

Accession Type Chr Start End Strand
OR52K1.aApr07-unspliced main_exon CDS chr11 4,488,901 4,489,842 +
3UTR chr11 4,489,842 4,489,845 +