Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

OR52K2 Olfactory Receptor

Gene Symbol OR52K21 (View this gene in GeneCards)
Family 52
Subfamily K
Pseudogene No
CORP pseudogene probability score
Aliases OR11-7, HsOR11.3.6, ORL3404, ORL3405
External Ids HGNC: 15223   GeneBank: AB065791, BK004258, NM_001005172   ORDB: ORL3404, ORL3405   
Build #39 labels OR52K2
Chromosomal location 11:4,449,340-4,450,281 (+)
Cluster 11@5
Synteny CLIC#23
Remarks

Most Similar ORs in Humans (Paralogs)

Symbol Percent Length
OR52K1 90.76% 314
OR52K3P 86.54% 312

Most Similar ORs in other species (Orthologs)

Specie Symbol Percent Length
Dog OR52K1B 89% 313
Dog OR52K1 87% 314
Chimp CONTIG465.160-12707 97% 314
Mouse Or52k2 88% 314
Rat Or52k2 88% 314
Rat Or52k1 86% 314
Cow OR52K2 90% 314
Cow OR52K1 88% 314

Expression evidences

Source Accession
mRNA BC137248
GNF Atlas2 gnf1h10692_at

Sequence information

Nucleotide sequence ATGTCAGCCTCCAATATCACCTTAACACATCCAACTGCCTTCTTGTTGGTGGGGATTCCA
GGCCTGGAACACCTGCACATCTGGATCTCCATCCCTTTCTGCTTAGCATATACACTGGCC
CTGCTTGGAAACTGCACTCTCCTTCTCATCATCCAGGCTGATGCAGCCCTCCATGAACCC
ATGTACCTCTTTCTGGCCATGTTGGCAGCCATCGACCTGGTCCTTTCCTCCTCAGCACTG
CCCAAAATGCTTGCCATATTCTGGTTCAGGGATCGGGAGATAAACTTCTTTGCCTGTCTG
GCCCAGATGTTCTTCCTTCACTCCTTCTCCATCATGGAGTCAGCAGTGCTGCTGGCCATG
GCCTTTGACCGCTATGTGGCTATCTGCAAGCCACTGCACTACACCAAGGTCCTGACTGGG
TCCCTCATCACCAAGATTGGCATGGCTGCTGTGGCCCGGGCTGTGACACTAATGACTCCA
CTCCCCTTCCTGCTGAGATGTTTCCACTACTGCCGAGGCCCAGTGATCGCTCACTGCTAC
TGTGAACACATGGCTGTGGTGAGGCTGGCGTGTGGGGACACTAGCTTCAACAATATCTAT
GGCATCGCTGTGGCCATGTTTATTGTGGTGTTGGACCTGCTCCTTGTTATCCTGTCTTAT
ATCTTTATTCTTCAGGCAGTTCTACTGCTTGCCTCTCAGGAGGCCCGCTACAAGGCATTT
GGGACATGTGTCTCTCATATAGGTGCCATCTTAGCCTTCTACACAACTGTGGTCATCTCT
TCAGTCATGCACCGTGTAGCCCGCCATGCTGCCCCTCATGTCCACATCCTCCTTGCCAAT
TTCTATCTGCTCTTCCCACCCATGGTCAATCCCATAATCTATGGTGTCAAGACCAAGCAA
ATCCGTGAGAGCATCTTGGGAGTATTCCCAAGAAAGGATATG
Conceptual translation MSASNITLTHPTAFLLVGIPGLEHLHIWISIPFCLAYTLALLGNCTLLLIIQADAALHEP
MYLFLAMLAAIDLVLSSSALPKMLAIFWFRDREINFFACLAQMFFLHSFSIMESAVLLAM
AFDRYVAICKPLHYTKVLTGSLITKIGMAAVARAVTLMTPLPFLLRCFHYCRGPVIAHCY
CEHMAVVRLACGDTSFNNIYGIAVAMFIVVLDLLLVILSYIFILQAVLLLASQEARYKAF
GTCVSHIGAILAFYTTVVISSVMHRVARHAAPHVHILLANFYLLFPPMVNPIIYGVKTKQ
IRESILGVFPRKDM

Protein domains and features

Variations - SNPs

Chr Start End Type Variation AA Change SNP IDs
11 100 -100 NS G/A R/H 1000GP (YRI, YRI, YRI)
11 100 -100 SYN T/C T/T 1000GP (YRI, YRI)
11 4,450,046 4,450,046 NS G/A R/H 1000GP (CEU, CHBJPT)
11 4,450,243 4,450,243 NS C/T R/C 1000GP (CEU, CHBJPT)
11 4,450,270 4,450,270 NS A/G R/G 1000GP (CEU)
11 4,470,707 4,470,707 SYN C/T T/T rs61735705 (DbSNP)
11 4,470,939 4,470,939 NS C/T R/C rs11032296 (DbSNP)
11 4,470,950 4,470,950 SYN C/T A/A rs61747517 (DbSNP)
11 4,471,276 4,471,276 NS G/A R/H rs331537 (DbSNP)
11 4,471,393 4,471,393 NS A/T H/L rs61998219 (DbSNP)
11 4,471,469 4,471,469 NS A/C Q/H rs61997232 (DbSNP)
11 4,471,473 4,471,473 NS C/T R/C rs7934336 (DbSNP)

Variations - CNVs

Chr Start End Type Sources
CopyNumber 84 (Hasin)
11 4,055,945 4,510,188 CopyNumber Variation_3834 (DGV)
11 4,333,543 4,474,341 CopyNumber Variation_2164 (DGV)

Haplotypes

Protein haplotypes were calculated using the 1000 genomes project as described in Olender T. et. al. BMC Genomics 2012.

W28R R124C R236H H275L Q300H R302C R311G % Freq CORP
1 W R R H Q R R 75.04 0.038
2 W R H H Q C R 14.13 0.032
3 W R H H Q R R 4.84 0.032
4 W C H H Q R R 3.53 0.369
5 W R R H H R R 1.08 0.038
6 W R R H Q R G 0.54 0.038
7 W C R H Q R R 0.38 0.415
8 R R R H Q R R 0.23 0.038
9 W R H L Q R R 0.08 0.032
10 W R R H Q C R 0.08 0.038
11 W C H L Q R R 0.08 0.369

AceView Gene Models

The information is based on AceView gene models, constructed from cDNA sequences. The information might be incomplete.

Accession Type Chr Start End Strand
OR52K2.aApr07-unspliced main_exon CDS chr11 4,449,340 4,450,281 +
3UTR chr11 4,450,281 4,450,284 +