Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

OR52L2P Olfactory Receptor

Gene Symbol OR52L2P1 (View this gene in GeneCards)
Family 52
Subfamily L
Pseudogene Yes
CORP pseudogene probability score
Aliases OR11-74, HsOR11.3.96
External Ids HGNC: 14788   GeneBank: AB065820, BK004254, NG_003195, S65372   
Build #39 labels OR52L2
Chromosomal location 11:6,057,289-6,058,230 (-)
Cluster 11@6
Synteny CLIC#23
Remarks

Most Similar ORs in Humans (Paralogs)

Symbol Percent Length
OR52L1 91.4% 314

Most Similar ORs in other species (Orthologs)

Specie Symbol Percent Length
Dog OR52L1 84% 314
Dog OR52L2 84% 314
Chimp CONTIG465.5-9765 95% 314
Chimp CONTIG*********** 93% 314
Mouse Or52l1 86% 313
Rat Or52l1 86% 313
Rat Or52l1b 86% 313
Cow OR52L2 86% 312
Cow OR52L1 86% 312

Sequence information

Nucleotide sequence ATGGCGCTTAGCAATTCCAGCTGGAGGCTACCCCAGCCTTCTTTTTTCCTGGTAGGAATT
CCGGGTTTAGAGGAAAGCCAGCACTGGATCGCACTGCCCCTGGGCATCCTTTACCTCCTT
GCTCTAGTGGGCAATGTTACCATTCTCTTCATCATCTGGATGGACCCATCCTTGCACCAA
CCTATGTACCTCTTCCTGTCCATGCTAGCTGCCATCGACCTGGTTGTGGCCTCCTCCACT
GCACCCAAAGCCCTTGCAGTGCTCCTGGTTCGTGCCCAAGAGATTGGTTACACTGTCTGC
CTGATCCAGATGTTCTTCACCCATGCATTCTCCTCCATGGAGTCAGGGGTACTTGTGGCC
ATGGCTCTGGATCGCTATGTAGCCATTTGTCACCCCTTGCACCATTCCACGATCCTGCAT
CCAGGGGTCATAGGGCACATCGGAATGGTGGTGCTGGTGCGGGGATTACTACTCCTCATC
CCCTTCCTCATTCTGTTGCGAAAACTTATCTTCTGCCAAGCCACCATCATAGGCCATGCC
TATTGTGAACATATGGCTGTTGTGAAACTTGCCTGCTCAGAAACCACAGTCAATCGAGCT
TATGGGCTGACTGTGGCCTTGCTTGTGGTTGGGCTGGATGTCCTGGCCATTGGTGTTTCC
TATGCCCACATTCTCCAGGCAGTGCTGAAGGTACCAGGAAATGAGGCCCGACTTAAGGCG
TTTAGCACATGTGGCTCTCATGTTTGTGTCATCCTGGTCTTCTATATCCCGGGAATGTTC
TCCTTCCTCACTCACCGCTTTGGTCATCATGTACCCCATCACGTCCATGTTCTTCTGGCC
ATACTGTATCGCCTTGTGCCACCTGCACTCAATCCTCTTGTCTATGGGGTGAAGACCCAG
AAGATCCACCAGTGAGTGCTCAGGGTGTTTACACTAAAGGAT
Conceptual translation MALSNSSWRLPQPSFFLVGIPGLEESQHWIALPLGILYLLALVGNVTILFIIWMDPSLHQ
PMYLFLSMLAAIDLVVASSTAPKALAVLLVRAQEIGYTVCLIQMFFTHAFSSMESGVLVA
MALDRYVAICHPLHHSTILHPGVIGHIGMVVLVRGLLLLIPFLILLRKLIFCQATIIGHA
YCEHMAVVKLACSETTVNRAYGLTVALLVVGLDVLAIGVSYAHILQAVLKVPGNEARLKA
FSTCGSHVCVILVFYIPGMFSFLTHRFGHHVPHHVHVLLAILYRLVPPALNPLVYGVKTQ
KIHQXLRVFTLKD

Protein domains and features

Variations - SNPs

Chr Start End Type Variation AA Change SNP IDs
11 6,079,001 6,079,001 SNP A/G rs4448669 (DbSNP)
11 6,078,611 6,078,611 SNP A/G rs55876254 (DbSNP)
11 6,078,724 6,078,724 SNP A/G rs73406099 (DbSNP)
11 6,078,741 6,078,741 SNP C/G rs61733539 (DbSNP)
11 6,078,961 6,078,961 SNP C/T rs58557691 (DbSNP)
11 6,079,028 6,079,028 SNP C/T rs61735897 (DbSNP)
11 6,078,940 6,078,940 SNP G/A rs61735879 (DbSNP)
11 6,079,244 6,079,244 SNP T/C rs55742886 (DbSNP)
11 6,078,575 6,078,575 SNP T/C rs61739062 (DbSNP)
11 6,079,050 6,079,050 SNP T/C rs61739999 (DbSNP)
11 6,079,455 6,079,455 SNP T/C rs61729696 (DbSNP)
11 6,057,345 6,057,345 SNP C/T 1000GP (CEU)
11 6,057,771 6,057,771 SNP G/A 1000GP (CEU, CHBJPT)
11 6,057,798 6,057,798 SNP C/T 1000GP (CEU)
11 6,057,954 6,057,954 SNP G/A 1000GP (CEU)
11 6,058,194 6,058,194 SNP G/C 1000GP (CEU)
11 6,058,225 6,058,225 SNP C/T 1000GP (CEU)
11 100 -100 SNP C/T 1000GP (YRI, YRI, YRI, YRI, YRI, YRI, YRI, YRI)

Variations - CNVs

Chr Start End Type Sources
11 5,505,764 6,194,475 CopyNumber Variation_34458 (DGV)
11 6,076,999 6,117,545 CopyNumber Variation_71268 (DGV)

Haplotypes

Protein haplotypes were calculated using the 1000 genomes project as described in Olender T. et. al. BMC Genomics 2012.