Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

OR52M1 Olfactory Receptor

Gene Symbol OR52M11 (View this gene in GeneCards)
Family 52
Subfamily M
Pseudogene No
CORP pseudogene probability score 0.12 (functional)
Aliases OR11-11, HsOR11.3.10
External Ids HGNC: 15225   GeneBank: AB065789, AF546574-AF546587, BK004372, NM_001004137   
Build #39 labels OR52M1
Chromosomal location 11:4,545,191-4,546,141 (+)
Cluster 11@5
Synteny CLIC#23
Remarks

Most Similar ORs in Humans (Paralogs)

Symbol Percent Length
OR52M2P 78.12% 320

Most Similar ORs in other species (Orthologs)

Specie Symbol Percent Length
Dog OR52M1 91% 317
Chimp CONTIG465.154-6519 97% 317
Mouse Or52m1 90% 317
Rat Or52m1 91% 317
Cow OR52M1 87% 317

Expression evidences

Source Accession
mRNA AB463978
GNF Atlas2 gnf1h10684_at

Sequence information

Nucleotide sequence ATGCTCACTTTTCATAATGTCTGCTCAGTACCCAGCTCCTTCTGGCTCACTGGCATCCCA
GGGCTGGAGTCCCTACACGTCTGGCTCTCCATCCCCTTTGGCTCCATGTACCTGGTGGCT
GTGGTGGGGAATGTGACCATCCTGGCTGTGGTAAAGATAGAACGCAGCCTGCACCAGCCC
ATGTACTTTTTCTTGTGCATGTTGGCTGCCATTGACCTGGTTCTGTCTACTTCCACTATA
CCCAAACTTCTGGGAATCTTCTGGTTCGGTGCTTGTGACATTGGCCTGGACGCCTGCTTG
GGCCAAATGTTCCTTATCCACTGCTTTGCCACTGTTGAGTCAGGCATCTTCCTTGCCATG
GCTTTTGATCGCTACGTGGCCATCTGCAACCCACTACGTCATAGCATGGTGCTCACTTAT
ACAGTGGTGGGTCGTTTGGGGCTTGTTTCTCTCCTCCGGGGTGTTCTCTACATTGGACCT
CTGCCTCTGATGATCCGCCTGCGGCTGCCCCTTTATAAAACCCATGTTATCTCCCACTCC
TACTGTGAGCACATGGCTGTAGTTGCCTTGACATGTGGCGACAGCAGGGTCAATAATGTC
TATGGGCTGAGCATCGGCTTTCTGGTGTTGATCCTGGACTCAGTGGCTATTGCTGCATCC
TATGTGATGATTTTCAGGGCCGTGATGGGGTTAGCCACTCCTGAGGCTAGGCTTAAAACC
CTGGGGACATGCGCTTCTCACCTCTGTGCCATCCTGATCTTTTATGTTCCCATTGCTGTT
TCTTCCCTGATTCACCGATTTGGTCAGTGTGTGCCTCCTCCAGTCCACACTCTGCTGGCC
AACTTCTATCTCCTCATTCCTCCAATCCTCAATCCCATTGTCTATGCTGTTCGCACCAAG
CAGATCCGAGAGAGCCTTCTCCAAATACCAAGGATAGAAATGAAGATTAGA
Conceptual translation MLTFHNVCSVPSSFWLTGIPGLESLHVWLSIPFGSMYLVAVVGNVTILAVVKIERSLHQP
MYFFLCMLAAIDLVLSTSTIPKLLGIFWFGACDIGLDACLGQMFLIHCFATVESGIFLAM
AFDRYVAICNPLRHSMVLTYTVVGRLGLVSLLRGVLYIGPLPLMIRLRLPLYKTHVISHS
YCEHMAVVALTCGDSRVNNVYGLSIGFLVLILDSVAIAASYVMIFRAVMGLATPEARLKT
LGTCASHLCAILIFYVPIAVSSLIHRFGQCVPPPVHTLLANFYLLIPPILNPIVYAVRTK
QIRESLLQIPRIEMKIR

Protein domains and features

Variations - SNPs

Chr Start End Type Variation AA Change SNP IDs
11 4,567,108 4,567,107 Ins(1) -/T rs34601471 (DbSNP)
11 4,566,796 4,566,796 NS A/G M/V rs61751910 (DbSNP)
11 4,567,175 4,567,175 NS A/T Q/L rs35020860 (DbSNP)
11 4,567,335 4,567,335 NS C/G S/R rs2657167 (DbSNP)
11 4,566,883 4,566,883 NS C/G L/V rs61747524 (DbSNP)
11 4,566,446 4,566,446 NS C/T S/L rs7112010 (DbSNP)
11 4,566,790 4,566,790 NS C/T R/C rs61751908 (DbSNP)
11 4,566,513 4,566,513 SYN A/C I/I rs11032738 (DbSNP)
11 4,567,140 4,567,140 SYN A/C T/T rs61734243 (DbSNP)
11 4,566,939 4,566,939 SYN A/G K/K rs61747538 (DbSNP)
11 4,567,086 4,567,086 SYN A/G V/V rs61735146 (DbSNP)
11 4,566,711 4,566,711 SYN C/T D/D rs2709182 (DbSNP)
11 4,566,718 4,566,718 SYN C/T L/L rs61747646 (DbSNP)
11 4,566,870 4,566,870 SYN C/T S/S rs61747520 (DbSNP)
11 4,567,185 4,567,185 SYN C/T Y/Y rs12295898 (DbSNP)
11 4,567,152 4,567,152 SYN C/T C/C rs61734237 (DbSNP)
11 4,545,481 4,545,481 SYN C/T D/D 1000GP (CEU, CHBJPT)
11 4,546,105 4,546,105 NS C/G S/R 1000GP (CEU, CHBJPT)
11 4,545,640 4,545,640 SYN T/C S/S 1000GP (CEU, CHBJPT)
11 4,545,955 4,545,955 SYN T/C Y/Y 1000GP (CEU)
11 100 -100 NS C/A P/H 1000GP (YRI, YRI, YRI)
11 100 -100 SYN C/T D/D 1000GP (YRI, YRI, YRI, YRI, YRI, YRI)

Variations - CNVs

Chr Start End Type Sources
11 4,535,321 4,578,714 CopyNumber Variation_9173 (DGV)
11 4,566,321 4,569,371 CopyNumber #118 (Waszak)

Haplotypes

Protein haplotypes were calculated using the 1000 genomes project as described in Olender T. et. al. BMC Genomics 2012.

S9L P32H P131S I258T R298H S305R % Freq CORP
1 S P P I R S 57.76 0.138
2 S P P I R R 40.02 0.138
3 L P P I H R 0.92 0.138
4 S P S I R R 0.38 0.255
5 S H P I R R 0.38 0.138
6 S P P T R S 0.31 0.138
7 L P P I R R 0.15 0.138
8 S P P I H R 0.08 0.138

AceView Gene Models

The information is based on AceView gene models, constructed from cDNA sequences. The information might be incomplete.

Accession Type Chr Start End Strand
OR52M1.aApr07-unspliced main_exon CDS chr11 4,545,191 4,546,141 +
3UTR chr11 4,546,141 4,546,144 +