Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

OR52M2P Olfactory Receptor

Gene Symbol OR52M2P1 (View this gene in GeneCards)
Family 52
Subfamily M
Pseudogene Yes
CORP pseudogene probability score
Aliases OR11-5, HsOR11.3.9P, ORL3552
External Ids HGNC: 15226   GeneBank: BK004611, NG_004305   ORDB: ORL3552   
Build #39 labels OR52M2P, OR52M4
Chromosomal location 11:4,514,945-4,515,924 (-)
Cluster 11@5
Synteny CLIC#23
Remarks

Most Similar ORs in Humans (Paralogs)

Symbol Percent Length
OR52M1 78.12% 320

Most Similar ORs in other species (Orthologs)

Specie Symbol Percent Length
Dog OR52M2 84% 328
Dog OR52M1 81% 328
Chimp CONTIG465.154-6519 78% 320
Mouse Or52m2 84% 328
Rat Or52m2 84% 328
Cow OR52M2 82% 328

Sequence information

Nucleotide sequence ATGTTAACCCCTAATAATGCCTGCTCCGTGCCTACCTCTTTCCGGCTCACTGGCATCCCT
GGCCTGGAATCCCTGCACATCTGGCTCTCCATCCCCTTTGGCTCCATGTACCTGGTAGCT
GTGCTGGGGAACATAACCATCCTGGCAGTGGTAAGGATGGAGTACAGCCTGCATCAGCCC
ATGTACTTCTTCCTGTGCATGTTGGCTGTCATTGACTTGGTCCTGTCAACCTCTACCATG
CCCAAACTACTGGCCATCTTCTGGTTTGGTGCCCACAACATTGGTGTTAATGCCTGTTTG
GCCCAGATGTTCTTCATTCATTGCTTTGCCACTGTTGAGTCAGGCATCTTCCTTGCCATG
GCTTTTGATCACTATGTGGCCATCTGTGACCCACTGCATCATACCTTGTTGCTCACCCAT
GCTGTGGTGGGTCGTTTGGGGCTGGCTGCCCTCCTCCGGGGGGTAATCTACATTGGACCT
CTGCCCCTAGTGATTTGTCTGAGGTTGCCCCTTTACCACACCCAAATCATTGCCCATTCG
TACTGTGAGCACATGGCTGTGGTCACCTTGGCATGTGGTGTGACACAAGGGTCAACAACT
TATATGGAATGGGGATTGGCTTTCTGGTATTAATCCTGGATTCATTGGCCATCACTGCCT
CCTATGTGATGATTTTCAGGGCTGTAATGGGCTTGGCCACCTCTGAAGCCAGGCTTAAAA
CCTTAGGGACATGTGGCTCTCACATCTGTGCCATCCTCGTCTTCTACATCCCCATTGCTG
TTTCCTCTCTCACACACCGCTTTGGCCATCGTGTGCCTCCCCATATCCATATCCATATCC
ATATCCATATCCATATCCATATCCTTTTGGCCAACATTTACCTCCTCATCCCACCTATCC
TCAACCCAATAGTCTATGCTGTCCGCACAAAGCAGATCCGAGAGGCTCTTCTCCATATTA
AGGCAAGGACTCAAACCAGG
Conceptual translation MLTPNNACSVPTSFRLTGIPGLESLHIWLSIPFGSMYLVAVLGNITILAVVRMEYSLHQP
MYFFLCMLAVIDLVLSTSTMPKLLAIFWFGAHNIGVNACLAQMFFIHCFATVESGIFLAM
AFDHYVAICDPLHHTLLLTHAVVGRLGLAALLRGVIYIGPLPLVICLRLPLYHTQIIAHS
YCEHMAVVTLACG/DTRVNNLYGMGIGFLVLILDSLAITASYVMIFRAVMGLATSEARL
KTLGTCGSHICAILVFYIPIAVSSLTHRFGHRVPPHIHIHIHIHIHIHILLANIYLLIPP
ILNPIVYAVRTKQIREALLHIKARTQTR

Protein domains and features

Variations - SNPs

Chr Start End Type Variation AA Change SNP IDs
11 100 -100 SNP C/T 1000GP (YRI, YRI, YRI, YRI, YRI, YRI, YRI, YRI, YRI)
11 4,515,000 4,515,000 SNP C/T 1000GP (CEU, CHBJPT)
11 4,515,122 4,515,122 SNP A/T 1000GP (CHBJPT)
11 4,515,383 4,515,383 SNP T/C 1000GP (CEU, CHBJPT)
11 4,515,435 4,515,435 SNP C/T 1000GP (CEU, CHBJPT)
11 4,515,680 4,515,680 SNP T/C 1000GP (CEU)
11 4,515,789 4,515,789 SNP T/A 1000GP (CEU)
11 4,536,230 4,536,230 SNP T/C rs2566221 (DbSNP)
11 4,536,291 4,536,290 Ins(6) -/GGATAT rs71466175 (DbSNP)
11 4,536,320 4,536,320 SNP G/T rs73437894 (DbSNP)
11 4,536,335 4,536,334 Ins(6) -/ATATGG rs71050410 (DbSNP)
11 4,536,362 4,536,362 SNP A/G rs56389610 (DbSNP)
11 4,536,389 4,536,389 SNP G/T rs12802383 (DbSNP)
11 4,536,613 4,536,613 SNP T/C rs2566220 (DbSNP)
11 4,536,665 4,536,665 SNP C/T rs2709157 (DbSNP)
11 4,536,717 4,536,717 SNP C/T rs4910989 (DbSNP)
11 4,537,019 4,537,019 SNP A/T rs16906358 (DbSNP)

Variations - CNVs

Chr Start End Type Sources
11 4,510,137 4,562,393 CopyNumber Variation_38231 (DGV)
11 4,510,284 4,562,394 CopyNumber Variation_9172 (DGV)
11 4,510,285 4,562,458 CopyNumber Variation_2899 (DGV)
11 4,534,175 4,537,254 Deletion #196 (Waszak)
11 4,535,321 4,578,714 CopyNumber Variation_9173 (DGV)

Haplotypes

Protein haplotypes were calculated using the 1000 genomes project as described in Olender T. et. al. BMC Genomics 2012.