Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

OR52N1 Olfactory Receptor

Gene Symbol OR52N11 (View this gene in GeneCards)
Family 52
Subfamily N
Pseudogene No
CORP pseudogene probability score 0.31 (functional)
Aliases OR11-61, HsOR11.3.81, ORL3381
External Ids HGNC: 14853   GeneBank: AB065538, BK004306, NM_001001913   ORDB: ORL3381   
Build #39 labels OR52N1
Chromosomal location 11:5,787,857-5,788,816 (-)
Cluster 11@6
Synteny CLIC#23
Remarks

Most Similar ORs in Humans (Paralogs)

Symbol Percent Length
OR52N2 76.11% 314
OR52N4 73.33% 315
OR52N5 71.95% 303

Most Similar ORs in other species (Orthologs)

Specie Symbol Percent Length
Dog OR52N1 91% 319
Chimp CONTIG*********** 98% 320
Mouse Or52n1-ps 87% 317
Rat Or52n1 88% 317
Cow OR52N1 87% 320

Expression evidences

Source Accession
mRNA AK308796

Sequence information

Nucleotide sequence ATGTCATTTCTAAATGGCACCAGCCTAACTCCAGCTTCATTCATCCTAAATGGCATCCCT
GGTTTGGAAGATGTGCATTTGTGGATCTCCTTCCCACTGTGTACCATGTACAGCATTGCT
ATTACAGGGAACTTCGGCCTTATGTACCTCATCTACTGTGATGAGGCCTTACACAGACCT
ATGTATGTCTTCCTTGCCCTTCTTTCCTTCACAGATGTGCTCATGTGCACCAGCACCCTT
CCCAACACTCTCTTCATATTGTGGTTTAATCTCAAGGAGATTGATTTTAAAGCCTGCCTC
GCCCAGATGTTCTTTGTGCACACCTTCACAGGGATGGAGTCTGGGGTGCTCATGCTCATG
GCCCTGGACCACTGTGTGGCCATCTGCTTCCCTCTGCGTTATGCCACCATCCTCACTAAT
TCAGTCATTGCTAAAGCTGGGTTCCTCACTTTTCTTAGGGGTGTGATGCTTGTTATCCCT
TCCACTTTCCTCACCAAGCGCCTTCCATACTGCAAGGGCAACGTCATACCCCACACCTAC
TGTGACCACATGTCTGTGGCCAAGATATCTTGTGGTAATGTCAGGGTTAACGCCATCTAT
GGTTTGATAGTTGCCCTGCTGATTGGGGGCTTTGATATCCTGTGCATTACAATCTCCTAC
ACTATGATTCTTCAAGCAGTTGTGAGTCTATCATCAGCAGATGCTCGACAGAAGGCCTTC
AGCACCTGCACTGCCCACTTCTGTGCCATAGTCCTCACCTATGTTCCAGCCTTCTTTACC
TTCTTTACACACCATTTTGGGGGACACACCATTCCTCTACACATACATATTATTATGGCT
AATCTCTACCTACTAATGCCTCCCACAATGAACCCTATTGTGTATGGGGTGAAAACCAGG
CAGGTACGAGAAAGTGTCATTAGGTTCTTTCTTAAGGGAAAGGACAATTCTCATAACTTT
Conceptual translation MSFLNGTSLTPASFILNGIPGLEDVHLWISFPLCTMYSIAITGNFGLMYLIYCDEALHRP
MYVFLALLSFTDVLMCTSTLPNTLFILWFNLKEIDFKACLAQMFFVHTFTGMESGVLMLM
ALDHCVAICFPLRYATILTNSVIAKAGFLTFLRGVMLVIPSTFLTKRLPYCKGNVIPHTY
CDHMSVAKISCGNVRVNAIYGLIVALLIGGFDILCITISYTMILQAVVSLSSADARQKAF
STCTAHFCAIVLTYVPAFFTFFTHHFGGHTIPLHIHIIMANLYLLMPPTMNPIVYGVKTR
QVRESVIRFFLKGKDNSHNF

Protein domains and features

Variations - SNPs

Chr Start End Type Variation AA Change SNP IDs
11 5,809,248 5,809,248 NS A/C W/G rs11039036 (DbSNP)
11 5,809,548 5,809,548 NS A/G C/R rs7948009 (DbSNP)
11 5,809,308 5,809,308 NS A/T F/I rs7934670 (DbSNP)
11 5,809,746 5,809,746 NS C/T A/T rs10742787 (DbSNP)
11 5,809,673 5,809,673 NS C/T C/Y rs10769224 (DbSNP)
11 5,809,811 5,809,811 NS G/T T/N rs12365487 (DbSNP)
11 5,809,230 5,809,230 SYN A/G L/L rs12794769 (DbSNP)
11 5,809,477 5,809,477 SYN A/G S/S rs10838637 (DbSNP)
11 5,809,990 5,809,990 SYN A/G I/I rs11039038 (DbSNP)
11 5,809,288 5,809,288 SYN C/G T/T rs35850861 (DbSNP)
11 5,809,405 5,809,405 SYN C/T L/L rs11823184 (DbSNP)
11 5,788,318 5,788,318 NS G/A R/C 1000GP (CEU, CHBJPT)
11 5,788,078 5,788,078 NS A/T F/I 1000GP (CEU, CHBJPT)
11 5,788,760 5,788,760 SYN G/A I/I 1000GP (CEU, CHBJPT)
11 5,788,000 5,788,000 SYN G/A L/L 1000GP (CEU, CHBJPT)
11 5,788,581 5,788,581 NS G/T T/N 1000GP (CEU, CHBJPT)
11 5,788,247 5,788,247 SYN A/G S/S 1000GP (CEU, CHBJPT)
11 5,788,516 5,788,516 NS C/T A/T 1000GP (CEU, CHBJPT)
11 5,788,443 5,788,443 NS C/T C/Y 1000GP (CEU, CHBJPT)
11 100 -100 NS T/C H/R 1000GP (YRI, YRI, YRI, YRI, YRI, YRI, YRI, YRI)
11 100 -100 SYN A/G S/S 1000GP (YRI)

Variations - CNVs

Chr Start End Type Sources
11 5,782,093 5,812,233 CopyNumber Variation_0414 (DGV), Variation_34987 (DGV)
11 5,776,623 5,842,356 CopyNumber Variation_2902 (DGV)
11 5,730,377 5,970,717 CopyNumber Variation_3836 (DGV)
11 5,784,484 5,809,387 CopyNumber Variation_6926 (DGV)
11 5,783,884 5,810,228 CopyNumber Variation_23218 (DGV)
11 5,505,764 6,194,475 CopyNumber Variation_34458 (DGV)
11 5,783,630 5,809,284 CopyNumber Variation_37479 (DGV)
11 5,788,080 5,809,139 CopyNumber Variation_38053 (DGV)
11 5,784,575 5,809,283 CopyNumber Variation_41250 (DGV)
11 5,784,556 5,809,291 CopyNumber Variation_43822 (DGV)
11 5,784,695 5,809,362 CopyNumber Variation_58525 (DGV)
11 5,784,859 5,809,285 CopyNumber Variation_65851 (DGV)
11 5,782,017 5,809,657 CopyNumber Variation_75531 (DGV), Variation_85631 (DGV)
11 5,791,622 5,809,657 CopyNumber Variation_75532 (DGV)
11 5,783,842 5,809,435 CopyNumber Variation_101118 (DGV)
11 5,809,387 5,810,189 InDel Variation_11053 (DGV)
Deletion 247 (Hasin)
11 5,807,087 5,810,146 Deletion, CopyNumber #312 (Waszak)
11 5,784,438 5,809,353 Del(-24708) #12(modil)

Haplotypes

Protein haplotypes were calculated using the 1000 genomes project as described in Olender T. et. al. BMC Genomics 2012.

H269R F247I K172N R167C C125Y V116L T108I A101T % Freq CORP
1 H I K C C V T A 55.68 0.397
2 H I K R Y V T T 28.96 0.502
3 H F K R C V T A 7.14 0.397
4 H I K R C V T A 4.92 0.397
5 R I K R Y V I T 1.61 0.502
6 H I N R C V T A 0.69 0.397
7 R I K R Y V T T 0.46 0.502
8 H I K R Y V T A 0.15 0.502
9 H I K R Y L T T 0.15 0.502
10 H F K R Y V T T 0.08 0.502
11 H I K C Y V T T 0.08 0.502
12 H I K C Y V T A 0.08 0.502

AceView Gene Models

The information is based on AceView gene models, constructed from cDNA sequences. The information might be incomplete.

Accession Type Chr Start End Strand
OR52N1.aApr07-unspliced main_exon 3UTR chr11 5,787,854 5,787,857 -
CDS chr11 5,787,857 5,788,816 -