Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

OR52N2 Olfactory Receptor

Gene Symbol OR52N21 (View this gene in GeneCards)
Family 52
Subfamily N
Pseudogene No
CORP pseudogene probability score 0.09 (functional)
Aliases OR11-57, HsOR11.3.83, ORL3324
External Ids HGNC: 15228   GeneBank: AB065816, BK004303, NM_001005174   ORDB: ORL3324   
Build #39 labels OR52N2
Chromosomal location 11:5,820,336-5,821,298 (+)
Cluster 11@6
Synteny CLIC#23
Remarks

Most Similar ORs in Humans (Paralogs)

Symbol Percent Length
OR52N1 76.11% 314
OR52N3P 75.16% 314
OR52N4 72.7% 315

Most Similar ORs in other species (Orthologs)

Specie Symbol Percent Length
Dog OR52N2 89% 316
Chimp CONTIG*********** 98% 321
Mouse Or52n2 89% 318
Mouse Or52n2c 88% 318
Rat Or52n2e 88% 318
Rat Or52n2 89% 316
Rat Or52n2f 86% 318
Rat Or52n2b 83% 314
Cow OR52N2 89% 320
Cow OR52N2H 88% 320
Cow OR52N2G 86% 314

Expression evidences

Source Accession
ESTs EG328810
mRNA BC140732
GNF Atlas2 gnf1h01944_at

Sequence information

Nucleotide sequence ATGTCTGGGGACAACAGCTCCAGCCTGACCCCAGGATTCTTTATCTTGAATGGCGTTCCT
GGGCTGGAAGCCACACACATCTGGATCTCCCTGCCATTCTGCTTTATGTACATCATTGCT
GTCGTGGGGAACTGTGGGCTCATCTGCCTCATCAGCCATGAGGAGGCCCTGCACCGGCCC
ATGTACTACTTCCTGGCCCTGCTCTCCTTCACTGATGTCACCTTGTGCACCACCATGGTA
CCTAATATGCTGTGCATATTCTGGTTCAACCTCAAGGAGATTGACTTTAACGCCTGCCTG
GCCCAGATGTTTTTTGTCCATATGCTGACAGGGATGGAGTCTGGGGTGCTCATGCTCATG
GCCCTGGACCGCTATGTGGCCATCTGCTACCCCTTACGCTATGCCACCATCCTTACCAAC
CCTGTCATCGCCAAGGCTGGTCTTGCCACCTTCTTGAGGAATGTGATGCTCATCATCCCA
TTCACTCTCCTCACCAAGCGCCTGCCCTATTGCCGGGGGAACTTCATCCCCCACACCTAC
TGTGACCATATGTCTGTGGCCAAGGTATCCTGTGGCAATTTCAAGGTCAATGCTATTTAT
GGTCTGATGGTTGCTCTCCTGATTGGTGTGTTTGATATCTGCTGTATCTCTGTATCTTAC
ACTATGATTTTGCAGGCTGTTATGAGCCTGTCATCAGCAGATGCTCGTCACAAAGCCTTC
AGCACCTGCACATCTCACATGTGTTCCATTGTGATCACCTATGTTGCTGCTTTTTTCACT
TTTTTCACTCATCGTTTTGTAGGACACAATATCCCAAACCACATACACATCATCGTGGCC
AACCTTTATCTGCTACTGCCTCCTACCATGAACCCAATTGTTTATGGAGTCAAGACCAAG
CAGATTCAGGAAGGTGTAATTAAATTTTTACTTGGAGACAAGGTTAGTTTTACCTATGAC
AAA
Conceptual translation MSGDNSSSLTPGFFILNGVPGLEATHIWISLPFCFMYIIAVVGNCGLICLISHEEALHRP
MYYFLALLSFTDVTLCTTMVPNMLCIFWFNLKEIDFNACLAQMFFVHMLTGMESGVLMLM
ALDRYVAICYPLRYATILTNPVIAKAGLATFLRNVMLIIPFTLLTKRLPYCRGNFIPHTY
CDHMSVAKVSCGNFKVNAIYGLMVALLIGVFDICCISVSYTMILQAVMSLSSADARHKAF
STCTSHMCSIVITYVAAFFTFFTHRFVGHNIPNHIHIIVANLYLLLPPTMNPIVYGVKTK
QIQEGVIKFLLGDKVSFTYDK

Protein domains and features

Variations - SNPs

Chr Start End Type Variation AA Change SNP IDs
11 5,842,356 5,842,356 NS A/G H/R rs8181512 (DbSNP)
11 5,841,701 5,841,701 NS A/G R/G rs73394370 (DbSNP)
11 5,841,926 5,841,926 NS A/G T/A rs73394377 (DbSNP)
11 5,842,283 5,842,283 NS A/T I/F rs61875922 (DbSNP)
11 5,842,384 5,842,384 NS C/G N/K rs62621415 (DbSNP)
11 5,841,743 5,841,743 NS C/T P/S rs73394373 (DbSNP)
11 5,842,310 5,842,310 NS G/T A/S rs8181529 (DbSNP)
11 5,842,081 5,842,081 SYN A/G R/R rs73394378 (DbSNP)
11 5,841,778 5,841,778 SYN A/T T/T rs73394374 (DbSNP)
11 5,841,856 5,841,856 SYN C/T N/N rs4758435 (DbSNP)
11 5,821,080 5,821,080 NS T/G S/A 1000GP (CEU, CHBJPT)
11 5,821,099 5,821,099 NS T/G V/G 1000GP (CEU)
11 5,821,053 5,821,053 NS T/A F/I 1000GP (CEU)
11 5,821,154 5,821,154 NS C/G N/K 1000GP (CEU)
11 5,820,626 5,820,626 SYN C/T N/N 1000GP (CEU, CHBJPT)
11 5,820,471 5,820,471 NS G/A G/R 1000GP (CEU)
11 5,821,126 5,821,126 NS A/G H/R 1000GP (CEU, CHBJPT)
11 5,820,851 5,820,851 SYN G/A R/R 1000GP (CEU)
11 5,821,264 5,821,264 NS T/C L/S 1000GP (CEU)
11 5,820,696 5,820,696 NS G/A A/T 1000GP (CEU)
11 5,820,548 5,820,548 SYN T/A T/T 1000GP (CEU)
11 100 -100 SYN T/C N/N 1000GP (YRI, YRI, YRI, YRI)
11 100 -100 NS G/A G/R 1000GP (YRI, YRI, YRI, YRI, YRI, YRI, YRI, YRI, YRI)

Variations - CNVs

Chr Start End Type Sources
11 5,776,623 5,842,356 CopyNumber Variation_2902 (DGV)
11 5,730,377 5,970,717 CopyNumber Variation_3836 (DGV)
11 5,505,764 6,194,475 CopyNumber Variation_34458 (DGV)
11 5,841,068 5,841,856 InDel Variation_48855 (DGV)

Haplotypes

Protein haplotypes were calculated using the 1000 genomes project as described in Olender T. et. al. BMC Genomics 2012.

G46R P60S A121T T162N K238E F240I S249A V255G H264R N273K % Freq CORP
1 G P A T K F S V H N 48.23 0.101
2 G P A T K F A V R N 41.94 0.183
3 G S A T K F A V R N 3.92 0.324
4 R P T T K F A G H K 3.46 0.117
5 G P A T E F A V H N 0.84 0.081
6 G P A N K F A V H N 0.46 0.081
7 G P A T K F A V H N 0.31 0.081
8 G P T T K F A G H K 0.15 0.117
9 G P A T K I S V H N 0.15 0.170
10 R P T T K F A G H N 0.15 0.117
11 G P A T K F S V R N 0.15 0.222
12 G P A N K F A V R N 0.08 0.183
13 R S T T K F A G H K 0.08 0.221
14 G S T T K F A G H K 0.08 0.221

AceView Gene Models

The information is based on AceView gene models, constructed from cDNA sequences. The information might be incomplete.

Accession Type Chr Start End Strand
OR52N3PandOR52N2.aApr07 exon_5UTR chr11 5,801,208 5,801,304 +
exon_5UTR chr11 5,801,590 5,801,670 +
exon_5UTR chr11 5,803,788 5,803,869 +
main_exon 5UTR chr11 5,820,282 5,820,336 +
CDS chr11 5,820,336 5,821,298 +
3UTR chr11 5,821,298 5,821,301 +