Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

OR52N3P Olfactory Receptor

Gene Symbol OR52N3P1 (View this gene in GeneCards)
Family 52
Subfamily N
Pseudogene Yes
CORP pseudogene probability score
Aliases OR11-60, HsOR11.3.82P, ORL3522
External Ids HGNC: 15229   GeneBank: BK004567, NG_004221   ORDB: ORL3522   
Build #39 labels OR52N3P
Chromosomal location 11:5,800,364-5,801,321 (+)
Cluster 11@6
Synteny CLIC#23
Remarks

Most Similar ORs in Humans (Paralogs)

Symbol Percent Length
OR52N2 75.16% 314

Most Similar ORs in other species (Orthologs)

Specie Symbol Percent Length
Dog OR52N3 86% 320
Chimp CONTIG465.30-16507 97% 320
Mouse Or52n3 81% 314
Rat Or52n3 81% 316
Cow OR52N2G 77% 318

Expression evidences

Source Accession
ESTs DN831986

Sequence information

Nucleotide sequence ATGAATGGAGCCAACAGCTCCAGCCTGACACCAAGATATTTCATTCTCAGTGGCGTTCCT
GGGCTGGAAGCTGCACACATCTGGATCTCCCTGCCTTTCTGCTTCATGTACATCATTGTT
GTTTTGGGGAACTGTGGACTTATATACCTCATTAGCCATGAGGAGGCCCTGCACCAACCC
ACCTACTACTTCCTAGACTTGCTGTCTCTTACAGATGTTACTGGATGCACCTCATTTGTT
CCCAATATGTTATGTATTTTTTGGTTTGGCCTCAAGGAAATTGACTTTAATGCCTGCCTT
GTGCAGATGTTTTTCATCCACATGCTGACAGGCATGGAGTCTGGGGCGCTCATGCTTATG
GCTCTAGACCGCTATGTGGCCATTTGCTACCCTCTACACTATTCCACCATCTTCACCAAC
ACTGTAATTACCAAAGTTGGGCTTGTCACCTTCATTCAAAGTGTGTTGCTTATGATTCCA
TTTGCTTTCCTGATCAAGTGTCTTCCCTATTGCAGGGGCAACCTCATCCACCACACCTAT
TTTAACATATGTCTGTGGCCAAATTATCCTGTGGTAATGTCCAGATTAATGCCATCTATG
GTCTCATAGCTGCCATATTGATTGGGGGGTTTGACATGTTCTGTATCTCCATGTCTTACA
CCATGATTATCCGTGCTGTAGTGAATTTGTCATCTGCAGATGCTGCCACAAAGCCTTCAG
TACCTGTACAGCACATATATGTGCTATTTTCATCACTTATGTCCCAGCCTTTTTCAACTT
CTTCACTCACCGCTTTGGGGGACACACCATACCTCATCATGTTCACATTTTTATAGCCAA
CCTTTACCTGATGCTGCCTCCCACCTTAAATCCAATTGTCTATGGAGTGAAGACCAAGCA
GATCCGTGAAGGAGTGATCAAATTGTTTTTTAGAGAGAAAGGTATTTTAAGTATGACA
Conceptual translation MNGANSSSLTPRYFILSGVPGLEAAHIWISLPFCFMYIIVVLGNCGLIYLISHEEALHQP
TYYFLDLLSLTDVTGCTSFVPNMLCIFWFGLKEIDFNACLVQMFFIHMLTGMESGALMLM
ALDRYVAICYPLHYSTIFTNTVITKVGLVTFIQSVLLMIPFAFLIKCLPYCRGNLIHHTY
/XMSVAKLSCGNVQINAIYGLIAAILIGGFDMFCISMSYTMIIRAVVNLSS/RCCHK
AFSTCTAHICAIFITYVPAFFNFFTHRFGGHTIPHHVHIFIANLYLMLPPTLNPIVYGVK
TKQIREGVIKLFFREKGILSMT

Protein domains and features

Variations - SNPs

Chr Start End Type Variation AA Change SNP IDs
11 5,821,699 5,821,699 SNP A/C rs7940926 (DbSNP)
11 5,821,745 5,821,745 SNP A/T rs73392251 (DbSNP)
11 5,800,469 5,800,469 SNP A/C 1000GP (CEU, CHBJPT)
11 5,801,012 5,801,012 SNP C/T 1000GP (CHBJPT)
11 100 -100 SNP A/C 1000GP (YRI, YRI, YRI, YRI, YRI, YRI)

Variations - CNVs

Chr Start End Type Sources
11 5,776,623 5,842,356 CopyNumber Variation_2902 (DGV)
11 5,730,377 5,970,717 CopyNumber Variation_3836 (DGV)
11 5,505,764 6,194,475 CopyNumber Variation_34458 (DGV)
CopyNumber 223 (Hasin)
11 5,821,494 5,824,551 CopyNumber #63 (Waszak)

Haplotypes

Protein haplotypes were calculated using the 1000 genomes project as described in Olender T. et. al. BMC Genomics 2012.