Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

OR52N5 Olfactory Receptor

Gene Symbol OR52N51 (View this gene in GeneCards)
Family 52
Subfamily N
Pseudogene No
CORP pseudogene probability score 0.07 (functional)
Aliases OR11-62, HsOR11.3.80, ORL3436
External Ids HGNC: 15231   GeneBank: AB065535, BK004300, NM_001001922   ORDB: ORL3436   
Build #39 labels OR52N5
Chromosomal location 11:5,777,663-5,778,634 (-)
Cluster 11@6
Synteny CLIC#23
Remarks

Most Similar ORs in Humans (Paralogs)

Symbol Percent Length
OR52N1 71.95% 303
OR52N2 73.62% 307
OR52N4 70.16% 305

Most Similar ORs in other species (Orthologs)

Specie Symbol Percent Length
Dog OR52N1 74% 309
Chimp CONTIG*********** 96% 325
Mouse Or52n5 89% 307
Rat Or52n5 91% 287
Cow OR52N5 87% 311
Cow OR52N5B 86% 310

Expression evidences

Source Accession
mRNA BC136981
GNF Atlas2 gnf1h10690_at

Sequence information

Nucleotide sequence ATGCCTCTATTTAATTCATTATGCTGGTTTCCAACAATTCATGTGACTCCTCCATCTTTT
ATTCTTAATGGAATACCTGGTCTGGAAAGAGTACATGTATGGATCTCCCTCCCACTCTGC
ACAATGTACATCATCTTCCTTGTGGGGAATCTTGGTCTTGTGTACCTCATTTATTATGAG
GAGTCCTTACATCATCCGATGTATTTTTTTTTTGGCCATGCTCTCTCCCTCATTGACCTC
CTTACCTGCACCACCACTCTACCCAATGCACTCTGCATCTTCTGGTTCAGTCTCAAAGAA
ATTAACTTCAATGCTTGCTTGGCCCAGATGTTCTTTGTTCATGGGTTCACAGGTGTGGAG
TCTGGGGTGCTCATGCTCATGGCTCTAGACCGCTATGTAGCCATTTGCTACCCTTTGCGT
TATGCTACCACACTCACCAACCCTATCATTGCCAAGGCTGAGCTTGCCACCTTCCTGAGG
GGTGTATTGCTGATGATTCCTTTCCCATTCTTGGTTAAGCGTTTGCCTTTCTGCCAAAGC
AATATTATCTCCCATACGTACTGCGACCACATGTCTGTAGTAAAGCTATCTTGTGCCAGC
ATCAAGGTCAATGTAATCTATGGTCTAATGGTTGCTCTCCTGATTGGAGTGTTTGACATT
TGTTGTATATCTTTGTCTTACACTTTGATCCTCAAGGCAGCGATCAGCCTCTCTTCATCA
GATGCTCGGCAGAAGGCTTTCAGCACCTGCACTGCCCATATATCTGCCATCATCATCACC
TATGTTCCAGCATTCTTCACTTTCTTTGCCCACCGTTTTGGGGGACACACAATTCCCCCT
TCTCTTCACATCATTGTGGCTAATCTTTATCTTCTTCTTCCCCCAACTCTAAACCCTATT
GTTTATGGAGTAAAGACAAAACAGATACGCAAGAGTGTCATAAAGTTCTTCCAGGGTGAT
AAGGGTGCAGGT
Conceptual translation MPLFNSLCWFPTIHVTPPSFILNGIPGLERVHVWISLPLCTMYIIFLVGNLGLVYLIYYE
ESLHHPMYFFFGHALSLIDLLTCTTTLPNALCIFWFSLKEINFNACLAQMFFVHGFTGVE
SGVLMLMALDRYVAICYPLRYATTLTNPIIAKAELATFLRGVLLMIPFPFLVKRLPFCQS
NIISHTYCDHMSVVKLSCASIKVNVIYGLMVALLIGVFDICCISLSYTLILKAAISLSSS
DARQKAFSTCTAHISAIIITYVPAFFTFFAHRFGGHTIPPSLHIIVANLYLLLPPTLNPI
VYGVKTKQIRKSVIKFFQGDKGAG

Protein domains and features

Variations - SNPs

Chr Start End Type Variation AA Change SNP IDs
11 5,799,468 5,799,468 NS C/T V/I rs12360738 (DbSNP)
11 5,799,481 5,799,481 SYN A/G A/A rs17230251 (DbSNP)
11 5,778,238 5,778,238 NS C/T V/I 1000GP (CEU, CHBJPT)
11 5,777,908 5,777,908 NS G/A R/W 1000GP (CHBJPT)
11 5,777,937 5,777,937 NS G/C A/G 1000GP (CHBJPT)
11 100 -100 NS C/T G/R 1000GP (YRI)

Variations - CNVs

Chr Start End Type Sources
11 5,782,093 5,812,233 CopyNumber Variation_0414 (DGV), Variation_34987 (DGV)
11 5,776,623 5,842,356 CopyNumber Variation_2902 (DGV)
11 5,730,377 5,970,717 CopyNumber Variation_3836 (DGV)
11 5,784,484 5,809,387 CopyNumber Variation_6926 (DGV)
11 5,783,884 5,810,228 CopyNumber Variation_23218 (DGV)
11 5,784,904 5,809,056 CopyNumber Variation_30540 (DGV)
11 5,799,860 5,807,979 CopyNumber Variation_31804 (DGV)
11 5,505,764 6,194,475 CopyNumber Variation_34458 (DGV)
11 5,783,630 5,809,284 CopyNumber Variation_37479 (DGV)
11 5,788,080 5,809,139 CopyNumber Variation_38053 (DGV)
11 5,784,575 5,809,283 CopyNumber Variation_41250 (DGV)
11 5,784,556 5,809,291 CopyNumber Variation_43822 (DGV)
11 5,777,210 5,805,515 CopyNumber Variation_48854 (DGV)
11 5,784,695 5,809,362 CopyNumber Variation_58525 (DGV)
11 5,784,859 5,809,285 CopyNumber Variation_65851 (DGV)
11 5,782,017 5,809,657 CopyNumber Variation_75531 (DGV), Variation_85631 (DGV)
11 5,791,622 5,809,657 CopyNumber Variation_75532 (DGV)
11 5,783,842 5,809,435 CopyNumber Variation_101118 (DGV)
Deletion 246 (Hasin)
11 5,796,893 5,799,964 Deletion #17 (Waszak)
11 5,784,438 5,809,353 Del(-24708) #13(modil)

Haplotypes

Protein haplotypes were calculated using the 1000 genomes project as described in Olender T. et. al. BMC Genomics 2012.

R243W I223T V133I G122R G118D % Freq CORP
1 R I V G G 81.41 0.083
2 R I I G G 16.28 0.083
3 R I V G D 0.84 0.083
4 R I V R G 0.61 0.083
5 R T V G G 0.38 0.083
6 W I V G G 0.31 0.069
7 W I I G G 0.08 0.069
8 R I I R G 0.08 0.083

AceView Gene Models

The information is based on AceView gene models, constructed from cDNA sequences. The information might be incomplete.

Accession Type Chr Start End Strand
OR52N5.aApr07-unspliced main_exon 3UTR chr11 5,777,660 5,777,663 -
CDS chr11 5,777,663 5,778,634 -