Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

OR52P2P Olfactory Receptor

Gene Symbol OR52P2P1 (View this gene in GeneCards)
Family 52
Subfamily P
Pseudogene Yes
CORP pseudogene probability score
Aliases HsOR11.3.5P, ORL3568
External Ids HGNC: 15233   GeneBank: AB065856, NG_004282   ORDB: ORL3568   
Build #39 labels OR52P2P
Chromosomal location 11:4,431,333-4,432,229 (-)
Cluster 11@5
Synteny CLIC#23
Remarks Coding for partial protein

Most Similar ORs in Humans (Paralogs)

Symbol Percent Length
OR52D1 53.72% 296
OR52K2 57.24% 290
OR52P1P 58.45% 296

Most Similar ORs in other species (Orthologs)

Specie Symbol Percent Length
Dog OR52P2 93% 299
Chimp CONTIG465.162-3978 99% 299
Mouse Or52p2 94% 299
Rat Or52p2 94% 299
Cow OR52P2 92% 299

Expression evidences

Source Accession
ESTs BI023089
GNF Atlas2 gnf1h05798_at

Sequence information

Nucleotide sequence ATGGGAATTCCAGGCCCGGAGGCATCCCACTTTTGGATTGCTTTTCCCTTCTGCTCCATG
TATGCCCTGGCAGTGCTGGGAAACATGGTGGTGCTGCTAGTGGTACATTCAGAGCCTGTA
TTGCACCAGCCCATGTACCTGTTCCTCTGCATGCTATCCACCATTGACCTGGTCCTCTGC
ACCTCCACTGTGCCCAAGCTCCTTGCACTTTTTTGGGCAAAGGATGCTGAGATCAACTTT
GGGGCCTGTGCTGCCCAGATGTTCTTTATCCATGGCTTCTCAGCTGTAGAATCTGGTATA
CTGCTAGCAATGGCCTTTGACCGCTACTTAGCCATTTGCTGGCCTCTGCACTATGGGTCA
TTGCTCTCCCCAGAGTCTGTAGGCAAGCTGGGGGCTGCAGCCGTGCTTCGTGGTTTGGGA
CTCATGACCCCACTCACCTGCTTACTGGCAAGACTGAGCTACTGCAGTCGAGTGGTGGCC
CACTCCTACTGTGAACACATGGCTGTGGTAAAGCTGGCTTGTGGAGGAACACAGCCAAAC
AACATCTATGGCATCACTGCTGCCACACTGGTGGTGGGCACTGACTCCATCTGTATTGCT
GTCTCCTATGCACTCATCCTCCGAGCTGTGTTAGGTCTTTCCTCCAAGGAGGCAAGGGCT
AAGACCTTTGGCACTTGTGGCTCCCACCTGGGTGTCATACTTCTCTTCTACACACCAGGA
CTCTTCTCCTTCTACACACAGCGGTTTGGCCAGCACGTGCCCCGGCACATCCACATCCTT
CTAGCTGACCTCTACCTGGTTGTGCCACCCATGCTCAACCCCATCATCTATGGCATGAAG
ACCAAACAGATCTGGGATGGGGCCCTCCGGCTTCTGAAGTGGGGCCCTGCTCAGTCA
Conceptual translation MGIPGPEASHFWIAFPFCSMYALAVLGNMVVLLVVHSEPVLHQPMYLFLCMLSTIDLVLC
TSTVPKLLALFWAKDAEINFGACAAQMFFIHGFSAVESGILLAMAFDRYLAICWPLHYGS
LLSPESVGKLGAAAVLRGLGLMTPLTCLLARLSYCSRVVAHSYCEHMAVVKLACGGTQPN
NIYGITAATLVVGTDSICIAVSYALILRAVLGLSSKEARAKTFGTCGSHLGVILLFYTPG
LFSFYTQRFGQHVPRHIHILLADLYLVVPPMLNPIIYGMKTKQIWDGALRLLKWGPAQS

Protein domains and features

Variations - SNPs

Chr Start End Type Variation AA Change SNP IDs
11 100 -100 SNP C/T 1000GP (YRI, YRI, YRI)
11 4,431,346 4,431,346 SNP C/T 1000GP (CEU)
11 4,431,594 4,431,594 SNP A/G 1000GP (CEU, CHBJPT)
11 4,431,635 4,431,635 SNP T/A 1000GP (CEU)
11 4,431,820 4,431,820 SNP C/T 1000GP (CEU)
11 4,431,985 4,431,985 SNP G/T 1000GP (CHBJPT)
11 4,452,576 4,452,576 SNP C/T rs7106422 (DbSNP)
11 4,452,824 4,452,824 SNP A/G rs7122384 (DbSNP)
11 4,452,865 4,452,865 SNP A/T rs11605909 (DbSNP)
11 4,452,924 4,452,924 SNP G/A rs61753393 (DbSNP)
11 4,453,050 4,453,050 SNP C/T rs11603357 (DbSNP)
11 4,453,137 4,453,137 SNP C/T rs73422022 (DbSNP)
11 4,453,224 4,453,224 SNP T/G rs61733340 (DbSNP)
11 4,453,394 4,453,394 SNP G/A rs61998189 (DbSNP)

Variations - CNVs

Chr Start End Type Sources
CopyNumber 83 (Hasin)
11 4,055,945 4,510,188 CopyNumber Variation_3834 (DGV)
11 4,333,543 4,474,341 CopyNumber Variation_2164 (DGV)
11 4,450,563 4,453,559 CopyNumber #51 (Waszak)

Haplotypes

Protein haplotypes were calculated using the 1000 genomes project as described in Olender T. et. al. BMC Genomics 2012.