Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

OR52R1 Olfactory Receptor

Gene Symbol OR52R11 (View this gene in GeneCards)
Family 52
Subfamily R
Pseudogene No
CORP pseudogene probability score
Aliases OR11-22, HsOR11.3.24, ORL3419
External Ids HGNC: 15235   GeneBank: AB065857, BK004282, NM_001005177   ORDB: ORL3419   
Build #39 labels OR52R1
Chromosomal location 11:4,803,436-4,804,380 (-)
Cluster 11@5
Synteny CLIC#23
Remarks Segregating Pseudo Gene, a nonsynonymous SNP in a highly conserved amino-acid (rs7941731)

Most Similar ORs in Humans (Paralogs)

Symbol Percent Length
OR52L1 57.47% 308
OR52L2P 55.84% 308
OR52N4 54.79% 303

Most Similar ORs in other species (Orthologs)

Specie Symbol Percent Length
Dog OR52R1 82% 314
Dog OR52R1D 81% 314
Chimp CONTIG465.133-13201 98% 315
Mouse Or52r1 82% 308
Mouse Or52r1c 82% 311
Mouse Or52r1b 81% 313
Rat Or52r1c 82% 313
Rat Or52r1 81% 308
Cow OR52R1 82% 311
Cow OR52R1E 81% 310
Cow OR52R1FP 80% 307

Sequence information

Nucleotide sequence ATGGTGCTGGCTTCAGGGAACAGCTCTTCTCATCCTGTGTCCTTCATCCTGCTTGGAATC
CCAGGCCTGGAGAGTTTCCAGTTGTGGATTGCCTTTCCGTTCTGTGCCACGTATGCTGTG
GCTGTTGTTGGAAATATCACTCTCCTCCATGTAATCAGAATTGACCACACCCTGCATGAG
CCCATGTACCTCTTTCTGGCCATGCTGGCCATCACTGACCTGGTCCTCTCCTCCTCCACT
CAACCTAAGATGTTGGCCATATTCTGGTTTCATGCTCATGAGATTCAGTACCATGCCTGC
CTCATCCAGGTGTTCTTCATCCATGCCTTTTCTTCTGTGGAGTCTGGGGTGCTCATGGCT
ATGGCCCTGGACTGCTACGTGGCTATCTGCTTCCCACTCCGACACTCTAGCATCCTGACC
CCATCGGTCGTGATCAAACTGGGGACCATCGTGATGCTGAGAGGGCTGCTGTGGGTGAGC
CCCTTCTGCTTCATGGTGTCTAGGATGCCCTTCTGCCAACACCAAGCCATTCCCCAGTCA
TACTGTGAGCACATGGCTGTGCTGAAGTTGGTGTGTGCTGATACAAGCATAAGTCGTGGG
AATGGGCTCTTTGTGGCCTTCTCTGTGGCTGGCTTTGATATGATTGTCATTGGTATGTCA
TACGTGATGATTTTGAGAGCTGTGCTTCAGTTGCCCTCAGGTGAAGCCCGCCTCAAAGCT
TTTAGCACACGTTCCTCCCATATCTGTGTCATCTTGGCTCTTTATATCCCAGCCCTTTTT
TCTTTCCTCACCTACCGCTTTGGCCATGATGTGCCCCGAGTTGTACACATCCTGTTTGCT
AATCTCTATCTACTGATACCTCCCATGCTCAACCCCATCATTTATGGAGTTAGAACCAAA
CAGATCGGGGACAGGGTTATCCAAGGATGTTGTGGAAACATCCCC
Conceptual translation MVLASGNSSSHPVSFILLGIPGLESFQLWIAFPFCATYAVAVVGNITLLHVIRIDHTLHE
PMYLFLAMLAITDLVLSSSTQPKMLAIFWFHAHEIQYHACLIQVFFIHAFSSVESGVLMA
MALDCYVAICFPLRHSSILTPSVVIKLGTIVMLRGLLWVSPFCFMVSRMPFCQHQAIPQS
YCEHMAVLKLVCADTSISRGNGLFVAFSVAGFDMIVIGMSYVMILRAVLQLPSGEARLKA
FSTRSSHICVILALYIPALFSFLTYRFGHDVPRVVHILFANLYLLIPPMLNPIIYGVRTK
QIGDRVIQGCCGNIP

Protein domains and features

Variations - SNPs

Chr Start End Type Variation AA Change SNP IDs
11 100 -100 NS G/T P/T 1000GP (YRI, YRI, YRI, YRI, YRI, YRI)
11 4,803,648 4,803,648 NS A/C S/A 1000GP (CEU, CHBJPT)
11 4,803,780 4,803,780 NS T/A N/Y 1000GP (CEU)
11 4,803,995 4,803,995 NS A/G I/T 1000GP (CEU, CHBJPT)
11 4,804,119 4,804,119 NS A/G F/L 1000GP (CEU)
11 4,804,297 4,804,297 SYN C/T L/L 1000GP (CEU)
11 4,804,336 4,804,336 SYN G/A F/F 1000GP (CEU)
11 4,824,752 4,824,752 NS T/G T/P rs61742567 (DbSNP)
11 4,824,878 4,824,878 NS C/A A/S rs2053116 (DbSNP)
11 4,825,010 4,825,010 NS A/T Y/N rs6578533 (DbSNP)
11 4,825,022 4,825,022 NS C/T V/I rs73403015 (DbSNP)
11 4,825,225 4,825,225 NS A/G I/T rs7941731 (DbSNP)
11 4,825,349 4,825,349 NS A/G F/L rs17327254 (DbSNP)
11 4,825,421 4,825,421 NS G/A L/F rs61740077 (DbSNP)
11 4,825,426 4,825,426 NS G/A T/M rs61746698 (DbSNP)
11 4,825,530 4,825,530 NS C/A Q/H rs61746977 (DbSNP)
11 4,825,566 4,825,566 SYN G/A F/F rs61744541 (DbSNP)

Variations - CNVs

Chr Start End Type Sources
CopyNumber 87 (Hasin)

Haplotypes

Protein haplotypes were calculated using the 1000 genomes project as described in Olender T. et. al. BMC Genomics 2012.

P287T S245A N201Y I197V I129T F88L L64F E60K Q27H % Freq CORP
1 P S N I I F L E Q 64.82 0.900
2 P A Y I T F L E Q 27.80 0.989
3 P A Y I T L L E Q 4.38 0.989
4 P S N I I F F E Q 1.77 0.900
5 P A Y V T F L K Q 0.31 0.989
6 P S Y I T F L E Q 0.31 0.989
7 T S N I I F L E Q 0.23 0.900
8 P A Y I T L L E H 0.15 0.989
9 P S N V I F L E Q 0.15 0.900
10 P A Y I I F L E Q 0.08 0.900

AceView Gene Models

The information is based on AceView gene models, constructed from cDNA sequences. The information might be incomplete.

Accession Type Chr Start End Strand
OR52R1.aApr07-unspliced main_exon 3UTR chr11 4,803,433 4,803,436 -
CDS chr11 4,803,436 4,804,380 -
5UTR chr11 4,804,380 4,804,617 -