Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

OR52S1P Olfactory Receptor

Gene Symbol OR52S1P1 (View this gene in GeneCards)
Family 52
Subfamily S
Pseudogene Yes
CORP pseudogene probability score
Aliases HsOR11.3.46P, ORL3505
External Ids HGNC: 14805   GeneBank: AF546588-AF546601, NG_002262   ORDB: ORL3505   
Build #39 labels OR52S1P
Chromosomal location 11:5,076,094-5,077,066 (-)
Cluster 11@5
Synteny CLIC#23
Remarks

Most Similar ORs in Humans (Paralogs)

Symbol Percent Length
OR52D1 57.65% 307
OR52K1 54.43% 305
OR52K2 55.02% 309

Most Similar ORs in other species (Orthologs)

Specie Symbol Percent Length
Dog OR52S1 88% 316
Chimp CONTIG465.105-5167 97% 267
Mouse Or52s1 86% 313
Mouse Or52s1b 83% 313
Rat Or52s1 85% 313
Rat Or52s1b 83% 313
Cow OR52S1P 81% 297
Cow OR52S1C 82% 263
Cow OR52S1D 81% 263

Sequence information

Nucleotide sequence ATGTCAGCATACAATAACACCAATGCCCGTCCATCAACCTTTATTCTTATTGGCATTCCT
GGGTTGGAAGCTGCTCACATCTGGATCTCCATCCCCTTTTGTGTGGTCTACCTGTTGGCC
CTACTGGGAAACGGCTCTCTTCTGTTTATCATCAAGACAGAGCCCAGCCTCCATGAGCCA
ATGTACCTCTTCCTATGCATGCTGGCTGTAGTTGATCTTGTTGTGTGTTCTACAGCTGTG
CCCAAACTTCTCAGTCTCTTCTGGTTCCATGATGGAGAGATTCGCTTTGAAACCTGCCTC
ACTCGTGTTCCTGATTCACTCTTGCTCCACCATGGAATCTGGCTTCTTCCTGGCCATGGC
TTTTGACCGATATGTGGCCATTTGCAATCCATTAAGACATTCAGCTATTCTGACACGCGC
TGTAATTGGGAGAGTGGGCCTAGCTATTGTTCTCAGGGGCATAGCACTTCTCAGTCCTCA
CTCTTTCCTACTACACTGGCTTCCCTACTGCAGAACCCATATCATTTCTCACACCTACTG
TGAGTTCATGGCCCTCATCAGGATTGCCTGTGCTGAGACAAAATTCCGCAGAGCCTACAG
CCTCATTGTTGCCTTCCTTACTGGGGTGGTAGACTTTATATTGATCATTTATTCTTATGT
CCTCATACTCCACACTGTCTTCCAGCTCCCATCCAAAGATGCCCGGCTCAAATCTTTGGG
CACCTGTGGCTCCCATGTCTGTGTCATCTTAGTATCCTATACTCCAGCCTTCTTCTCGTT
TCTCACCCACAGGTTTGGGCACCATGTGGCTCCCCATTTTCACATATTTGTGGCCAACAT
CTATCTTCTTGTCCCACCCATGGTGAACCCCATTATCTATGGGGTAAGAACCAAAAGGAT
TTGGGACAGGTTCCTTAAAGTTTTCAGTTTTTCAAAGCCTCTAAGTAAATCATTTTTGTT
GGTGAGAAATATC
Conceptual translation MSAYNNTNARPSTFILIGIPGLEAAHIWISIPFCVVYLLALLGNGSLLFIIKTEPSLHEP
MYLFLCMLAVVDLVVCSTAVPKLLSLFWFHDGEIRFETCLT//FLIHSCSTMESGFFL
AMAFDRYVAICNPLRHSAILTRAVIGRVGLAIVLRGIALLSPHSFLLHWLPYCRTHIISH
TYCEFMALIRIACAETKFRRAYSLIVAFLTGVVDFILIIYSYVLILHTVFQLPSKDARLK
SLGTCGSHVCVILVSYTPAFFSFLTHRFGHHVAPHFHIFVANIYLLVPPMVNPIIYGVRT
KRIWDRFLKVFSFSKPLSKSFLLVRNI

Protein domains and features

Variations - SNPs

Chr Start End Type Variation AA Change SNP IDs
11 5,097,802 5,097,802 SNP C/T rs10734476 (DbSNP)
11 5,097,519 5,097,519 SNP C/T rs72867688 (DbSNP)
11 5,076,572 5,076,572 SNP T/C 1000GP (CEU, CHBJPT)
11 5,076,573 5,076,573 SNP G/A 1000GP (CEU)
11 100 -100 SNP T/C 1000GP (YRI, YRI, YRI, YRI, YRI, YRI)

Variations - CNVs

Chr Start End Type Sources
11 4,907,893 5,135,331 CopyNumber Variation_3835 (DGV)
11 5,087,292 5,125,991 CopyNumber Variation_5421 (DGV)
CopyNumber 167 (Hasin)

Haplotypes

Protein haplotypes were calculated using the 1000 genomes project as described in Olender T. et. al. BMC Genomics 2012.