Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

OR52T1P Olfactory Receptor

Gene Symbol OR52T1P1 (View this gene in GeneCards)
Family 52
Subfamily T
Pseudogene Yes
CORP pseudogene probability score
Aliases OR11-46, HsOR11.3.73P, ORL3613
External Ids HGNC: 15236   GeneBank: BK004684, NG_004218   ORDB: ORL3613   
Build #39 labels OR52T1P
Chromosomal location 11:5,566,651-5,567,616 (-)
Cluster 11@5
Synteny CLIC#23
Remarks

Most Similar ORs in Humans (Paralogs)

Symbol Percent Length
OR52H1 54.43% 316
OR52H2P 54.78% 314

Most Similar ORs in other species (Orthologs)

Specie Symbol Percent Length
Dog OR52H4 64% 319
Chimp CONTIG15690.1-1022 92% 329
Mouse Or52h7 58% 316
Rat Or52h7 55% 326
Cow OR52H16P 58% 310

Sequence information

Nucleotide sequence ATGGCCACATTGAATTTAAGTAGCTTCAATCCAGGACTCTTCATTCTGTTGGGGATCCCA
GGGCTGGAGTGGTTCTGCATCTGGATGGGAATTCTCTCCTTTACCAGTTACCTTGTCTCC
CTTGTAGGGAATGTCATCCTTCTCTACCTTATCACTGTGGAACACAACCTCCATAAACCC
ATGTTTTCCTTCCTCTCTATACCGGCCTCTGCAAACCTCATATTATGCATTACATATTTC
CCCAAAACATTTGGGATATTCTAGCTGAAAGCTCAGAAAATAATATTTCCTGGATGCTTC
ACCAGGTTTTTTTTTTTTGGTCTACTTCACTTTAGCTTTTTTTCTGGACTTGGCCATCTT
GTTGGGTCTGGCATTTGATCATTACATGACCATTGGTTTCCTTCTGAGATACACCAGTGG
CTTGACACCTCGACACTTGGCAAGATTGTGGTGAGCATTGATTGAAGGTTTAATAACATT
TTGCCCATTGATTTCCTGGGGAAGCATTTGCCCTTCTGCAGAACACACATTAATTCTAAC
ACATACTGTGAGCACATAGGTGTGGCCCTGCTTTCCTATGCTGATATCTCCATCAATATC
TGGTATGACTTTACTATATTGGTAATGACTATTATCTCAGATCTGATCCTCACTGATATT
TCCTACACCCTCACCCTTCATGCTGTTTTCCACCTTCCATCCAGTGATGCCCTTCTGAAG
GCCCTAAGCACCGGTGGTTCTCATGTCAGTGTCATTCTCATGTTGTACACACCAGCCATG
CTTTCTGCCCTTACTCATCACTTTGGCCAGAGTATCTCTTGCACTTTTTACATTATGTTT
GTGGGCCTCTATAGGGCAATCCCTCCTGTACTCAATTCCATAATTATGGAGTAAAAACAA
AGCAGATTGGAATTATTCTTTCTTAAAGGGATGCAGTGATATGAGGATGAGAATATGGAT
AAATGG
Conceptual translation MATLNLSSFNPGLFILLGIPGLEWFCIWMGILSFTSYLVSLVGNVILLYLITVEHNLHKP
MFSFLSIPASANLILCITYFPKTFGIFXKAQKIIFPGCFTRFFFFGLLHFSFF/WT/
AILLGLAFDHYMTIGFLLRYTSGLTPRHL/KIVVSIDXFNNILPIDFLGKHLPFCRTH
INSNTYCEHIGVALLSYADISINIWYDFTILVMTIISDLILTDISYTLTLHAVFHLPSSD
ALLKALSTGGSHVSVILMLYTPAMLSALTHHFGQSISCTFYIMFVGLYRAIPPVLNSIIM
EXQSRLELFFLKGMQXEDENMDKW

Protein domains and features

Variations - SNPs

Chr Start End Type Variation AA Change SNP IDs
11 100 -100 SNP C/G 1000GP (YRI, YRI, YRI, YRI, YRI, YRI, YRI, YRI, YRI, YRI)
11 5,566,703 5,566,703 SNP A/G 1000GP (CEU)
11 5,566,704 5,566,704 SNP A/T 1000GP (CEU)
11 5,566,842 5,566,842 SNP C/T 1000GP (CEU, CHBJPT)
11 5,566,884 5,566,884 SNP C/A 1000GP (CEU, CHBJPT)
11 5,566,944 5,566,944 SNP T/C 1000GP (CEU, CHBJPT)
11 5,567,297 5,567,297 SNP C/A 1000GP (CHBJPT)
11 5,567,298 5,567,298 SNP C/A 1000GP (CEU, CHBJPT)
11 5,567,455 5,567,455 SNP T/C 1000GP (CEU, CHBJPT)
11 5,567,492 5,567,492 SNP A/G 1000GP (CEU, CHBJPT)
11 5,587,889 5,587,889 SNP C/G rs16932981 (DbSNP)
11 5,587,935 5,587,934 Ins(14) -/AAGTATGACCTTGT rs6144193 (DbSNP)
11 5,587,936 5,587,935 Ins(14) -/AAGTATGACCTTGT rs35154426 (DbSNP)
11 5,588,072 5,588,072 SNP C/T rs10769074 (DbSNP)
11 5,588,114 5,588,114 SNP A/C rs9804611 (DbSNP)
11 5,588,174 5,588,174 SNP C/T rs9804698 (DbSNP)
11 5,588,415 5,588,415 SNP C/T rs1433568 (DbSNP)
11 5,588,512 5,588,512 SNP C/G rs1433569 (DbSNP)
11 5,588,528 5,588,528 SNP A/C rs34148207 (DbSNP)
11 5,588,529 5,588,528 Ins(1) -/A rs35177274 (DbSNP)
11 5,588,530 5,588,529 Ins(1) -/A rs72416481 (DbSNP)
11 5,588,533 5,588,532 Ins(1) -/A rs67704720 (DbSNP)
11 5,588,538 5,588,537 Ins(1) -/A rs66740605 (DbSNP)
11 5,588,540 5,588,539 Ins(1) -/A rs11451429 (DbSNP)
11 5,588,541 5,588,540 Ins(1) -/A rs57589569 (DbSNP)
11 5,588,542 5,588,541 Ins(1) -/A rs66742326 (DbSNP)
11 5,588,685 5,588,685 SNP C/T rs7927505 (DbSNP)
11 5,588,722 5,588,722 SNP A/G rs7924363 (DbSNP)
11 5,588,841 5,588,841 Del(1) -/G rs35997399 (DbSNP)
11 5,588,842 5,588,842 Del(1) -/G rs10716874 (DbSNP)

Variations - CNVs

Chr Start End Type Sources
11 5,505,764 6,194,475 CopyNumber Variation_34458 (DGV)

Haplotypes

Protein haplotypes were calculated using the 1000 genomes project as described in Olender T. et. al. BMC Genomics 2012.