Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

OR52U1P Olfactory Receptor

Gene Symbol OR52U1P1 (View this gene in GeneCards)
Family 52
Subfamily U
Pseudogene Yes
CORP pseudogene probability score
Aliases HsOR11.3.75P, ORL3528
External Ids HGNC: 15237   GeneBank: NG_004217   ORDB: ORL3528   
Build #39 labels OR52U1P
Chromosomal location 11:5,719,290-5,720,266 (+)
Cluster 11@6
Synteny CLIC#23
Remarks

Most Similar ORs in Humans (Paralogs)

Symbol Percent Length
OR52D1 50.81% 309
OR52N2 49.35% 308
OR52N4 49.68% 308

Most Similar ORs in other species (Orthologs)

Specie Symbol Percent Length
Dog OR52U1 84% 323
Dog OR52U1C 82% 323
Dog OR52U1B 81% 323
Chimp CONTIG62965.1-878 96% 257
Chimp CONTIG78694.1-947 94% 214
Mouse Or52u1 85% 325
Rat Or52u1 86% 321
Cow OR52U1 83% 323
Cow OR52U1DP 83% 286

Sequence information

Nucleotide sequence ATGACTGCTTGCAATGCCTCACAGGGCCACCCTTCTTTCTTCATTCTCCAAGGAATTCCT
GGCATGGAGGACAAACACAGATGGATATCTATCCCCTTCTCCTCCATGTATTTCGTTATG
GTGCTTGGGAACTGCACCATCCTCCTCACCATCTCCACAGAGCGCTCCCTGCACAAACCC
ATGTTCCTGCTCCTCTGTCTGTTGGCCCTCACAGACCTGGGCATGTCTACAACCACCATT
CCCAAGGTGCTGTGCATTTTCTGGTTTGGCCAGAGTGAGATCAGCTATGAAGGATGCCTG
GTTCAGCTGTTCTTCATCCACTCCATCTCTGCCATGCAGTCAGCTGTCCTGATGACCATG
GCCTTTGACCACTATGTGGCCATCTGCAAGCCCTTGCGCTATGCCACCATCCTTTCCAAT
AGTTGCACTGGACTCATTGGCTTAGTGAGTTTGGTGAGAGCTATCCTCTTTATTCTCCCC
ATGCCCATCCTCCTTCAGCAAATGCCCTATCATGCCAATCGTGTCATCCCCACCACCTCC
TGTGAGCACATGGCTGTGGTGAAGATGGTTTGTGTAGATACTACAGTCAACAGGATATAT
GGCCTGGTGGTGGCCTTGTTGGTTGCTGGCTGGATCTCTCAGCTATTGCTTCATCTTATG
TGCTAATCATCCAGGCTATAATGCATCTCTCTTCTAAGGAAGCCCACCACAAAGCAGTCA
ACACCTGCACCACACACATCTGTGTCATGCTTATTTCTTATACTCCCTCACTTTTCTCTT
TTCTCGCTCACCGCTTTGGCCAAGGCATTCCACCCCATGTCCACATCATTCTTGGCAACC
TTTACTTCCTTGTACCTCCAATGCTCAGTCCTATAATTTATGGAGTGAAAACTAAGGAGT
TCTGGGACAAAGTGACCAAATAGGGTTGCTGGAAAGAAGAACCCACAACCACTGACCATG
GTCAGAAACTTGTCTGG
Conceptual translation MTACNASQGHPSFFILQGIPGMEDKHRWISIPFSSMYFVMVLGNCTILLTISTERSLHKP
MFLLLCLLALTDLGMSTTTIPKVLCIFWFGQSEISYEGCLVQLFFIHSISAMQSAVLMTM
AFDHYVAICKPLRYATILSNSCTGLIGLVSLVRAILFILPMPILLQQMPYHANRVIPTTS
CEHMAVVKMVCVDTTVNRIYGLVVALLV/WLDLSAIASSYVLIIQAIMHLSSKEAHHKA
VNTCTTHICVMLISYTPSLFSFLAHRFGQGIPPHVHIILGNLYFLVPPMLSPIIYGVKTK
EFWDKVTKXCWKEEPTTTDHGQKLVW

Protein domains and features

Variations - SNPs

Chr Start End Type Variation AA Change SNP IDs
11 5,740,971 5,740,971 Del(1) -/T rs34289607 (DbSNP)
11 5,741,204 5,741,204 SNP A/G rs34279421 (DbSNP)
11 5,741,102 5,741,102 SNP A/G rs12281165 (DbSNP)
11 5,741,151 5,741,151 SNP A/G rs10769200 (DbSNP)
11 5,740,634 5,740,634 SNP A/G rs12285602 (DbSNP)
11 5,740,683 5,740,683 SNP C/G rs73404276 (DbSNP)
11 5,741,117 5,741,117 SNP C/T rs35378018 (DbSNP)
11 5,719,404 5,719,404 SNP G/A 1000GP (CEU, CHBJPT)
11 5,719,887 5,719,887 SNP T/C 1000GP (CEU, CHBJPT)
11 5,719,921 5,719,921 SNP G/A 1000GP (CEU, CHBJPT)
11 5,719,974 5,719,974 SNP A/G 1000GP (CEU, CHBJPT)
11 5,719,872 5,719,872 SNP A/G 1000GP (CHBJPT)
11 100 -100 SNP G/A 1000GP (YRI, YRI, YRI, YRI, YRI, YRI)

Variations - CNVs

Chr Start End Type Sources
11 5,730,377 5,970,717 CopyNumber Variation_3836 (DGV)
11 5,505,764 6,194,475 CopyNumber Variation_34458 (DGV)

Haplotypes

Protein haplotypes were calculated using the 1000 genomes project as described in Olender T. et. al. BMC Genomics 2012.